KEGG   Drosophila sechellia: Dsec_GM20735Help
Entry
Dsec_GM20735      CDS       T01064                                 

Definition
GM20735 gene product from transcript GM20735-RA
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dse  Drosophila sechellia
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dse01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dse00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dse00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:dse00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2482 aa AA seqDB search
MLITILGTLAAFLAFLLTLIFGRGQKRSIPVQSSAATSATTATTGDSDNGNTNHNSSVIA
ATATATTTSSKPPIAPAAPPSAVKAGDKRFPKACIKKVQFSSESLRSDVEELCDQLKDSA
LSNLNNDNIRIACHQNNNNSSINKNQNNNSIDISISINKMSETNESNDTAAQTAEGERPS
FLVGDEIDERAAEAGEACDEFPQKMQSDVRQNGDISERRKRLRPSMSRGTGLGQDRHQDR
DFHIATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKL
PELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLKAQYSGKKIKISS
ELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPALFRQVQAEVPG
SPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFED
MEKAAVRLAKMVGYVSAGTVEYLYDPEGRYFFLELNPRLQVEHPCTEMVADVNLPAAQLQ
IGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSS
GTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSI
RGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQ
ITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKE
IEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLI
NMIVEDGAHVSKGQAFAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDP
SLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLSGYCLPEPFNAQRLRDIIEK
FMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASV
IDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYG
HYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLS
ELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLI
LSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLL
PTAHPNRLFSRMSSPDGLDQAAAESLGNSFVRTGAIAAFDSFEHFEMYSDEILDLLEDFV
SPAMVNAKVLEAVDAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRE
TGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIY
RHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHS
DLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIMDPAKIE
ESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQT
EPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMT
ERHWREFSKARPTVDIRTPDKILIECKELVLEGDNLVEMQRLPGENNCGMVAWRIVLATP
EYPNGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEE
VKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKD
DGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILT
GYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCD
LPIVLPSDRIERPVDFMPTKSPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAK
TVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQA
IKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELR
GGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYKEKDLIKTIHRLDPTTIGLKK
ELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVP
WRDSRRWLYWRLRRLLLEDAYIKKILRAQDNLSVGQAKQMLRRWLVEEKGATEAYLWDKN
EEMVSWYEEQINAESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGLTPVNR
GVVVRTLAQMQLNEETSNSNQG
NT seq 7449 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcacgatattaggcactctggctgcttttctcgcattcctcttgacattgatc
tttggccgcggccagaaaagatccatacccgtccaatcgtctgcagcaacatccgccacg
acagcaacaactggcgacagcgacaacggcaacaccaatcacaactccagcgtgattgca
gctacagcaacagcaacaaccaccagcagcaagcctcccattgctccagcagcacctcct
tcggcggttaaggcgggtgacaagcgattccccaaggcgtgcatcaagaaggtccagttc
tccagcgagagcctccggtccgacgtggaggagctgtgcgaccagctgaaggatagcgca
ctcagcaacctaaacaacgacaacatccgcatcgcctgccaccagaacaacaacaacagc
agcatcaacaagaaccagaacaacaacagcatcgacatcagcatcagcatcaacaagatg
agcgaaacaaatgagtccaatgacacggccgcccaaaccgccgagggtgagcgacccagc
tttttggtgggcgatgagatcgacgagcgggccgccgaggcgggcgaggcttgcgacgag
ttcccccagaagatgcagagcgatgtccgccagaatggggatatttccgagcggcgcaag
cggttaaggccgagtatgtcgcgtggcacagggctgggccaggaccggcaccaggatcgc
gacttccacatcgccaccaccgaggagttcgtgaagcgcttcggcggcacccgagtgatc
aacaaggtcctgattgccaacaacggtatcgcggccgtcaagtgcatgcgatccatccgg
agatgggcgtacgaaatgttcaagaacgagcgagccatcaggtttgtggtgatggtcact
ccggaggatctgaaggcgaatgccgaatacattaagatggcggatcactatgtgcccgtg
cccggcggatcgaacaacaacaactacgccaatgtcgagctcatcgtggacattgctctt
cgcacccaagtgcaggccgtgtgggctggttggggtcatgcctccgagaacccgaagctg
cctgagctgctccacaaagagggtctggtgttccttggccctccggaacgtgccatgtgg
gcgcttggcgacaaggtggcctcctcgattgtggcccaaactgccgaaattcccaccctg
ccgtggtccggatcggacctgaaggcccagtacagtggcaagaagatcaaaatttccagt
gagctcttcgcccgcggctgtgtgaccaatgtggaacagggtctggctgcagttaacaag
attggcttccccgtaatgatcaaggcctcggaaggaggtggtggcaagggtattcgccgc
gtggacaccactgaggagttccccgccctgttccgccaggtgcaagctgaggtgcccggc
tcaccaattttcgtgatgaagctggcacgcggagcccgccacttggaggtgcaactgctg
gcggatcagtacggcaatgccattagcttgttcggccgtgactgctccatccagcgtcgt
catcagaaaattattgaggaagctcctgccatcgtggcccagccagaggtgttcgaggac
atggagaaggccgccgtgcggctcgccaagatggtgggttacgtcagcgcgggaactgtg
gagtatctatatgatccggagggtcgctacttcttcctggagctgaacccccgtctgcag
gtggagcatccgtgtacggagatggtggccgatgtgaatcttcccgctgctcagctgcag
attggaatgggaattcccctttaccggctcaaggacatccgtctgttgtacggagagtct
ccgtggggctcctcagtcattgacttcgaaaatccaccgaacaaaccgcgtccctccgga
catgttatcgctgctcgtatcacctcggagaaccccgacgagggctttaagcccagttct
ggaaccgttcaggagcttaacttccggtcgagcaaaaatgtgtggggctacttcagtgtg
gctgccagtggaggattgcacgagttcgcggactcacagtttgggcattgtttctcctgg
ggcgagaatcgtcagcaggctcgagagaacctggtgattgccctgaaggagctgtccatt
cgaggtgatttccgaacgacggtggagtacctgatcactctgctggaaacgaatcggttc
ctcgacaacagcatcgacaccgcctggctagatgccttgatcgcagagcgtgtgcaatcc
gagaagcctgatatcctgttgggcgtaatgtgcggatcgctgcatatcgcagatcgtcaa
atcactgagagcttctccagcttccagacctctctggagaaaggtcagatccaagcagcg
aacacgctaacgaacgtggtggatgtggagctaatcaacgatggcatccgttacaaggtg
caggccgccaagagcggagccaactcgtacttcctgctgatgaacagctcgttcaaggag
atcgaggtgcaccgcctctccgacggaggtttgctcatctctttggagggcgcctcctac
accacgtacatgaaggaagaggtggatcgctaccgcattgtgattggcaaccagacatgt
gtcttcgaaaaggagaacgatccatcgctgctgcgcagtccgtctgcgggaaagctcatc
aacatgattgtggaagatggcgcacatgtaagcaagggccaggcctttgctgagattgag
gtgatgaagatggtgatgaccctgacgtcccaggaggcaggcacagtaacgtttgtgcgt
cgaccaggagctgttctggatgcaggatcccttttgggccacttggagctggacgatcca
tcgctggtgacgaaagcacagcccttcaagggtcagttcctgcagccagagaatgcaccg
gtgccggagaaactaaacagggtgcacaatacttacaagagcatccttgaaaacacactg
tctggttactgcctgccggaacctttcaatgcgcagagactgagggacattatcgagaaa
tttatgcaaagcttgcgggatccctcgttgccgctgttggagctgcaagaagttatcgcc
tccatctcaggccgcatacccatatccgtggagaagaagatccggaaactgatgacgctg
tacgagcgaaacataactagtgtgctggcccaattcccctcgcagcagatcgccagtgtt
attgacagccatgcggccacgctgcagaagcgcgctgaccgagatgtcttcttcctgacc
acccagagcattgtgcagctggtgcagcggtataggaacggaatccgcggcaggatgaag
gccgccgttcatgagctactgcgtcagtactacgatgtagagtcgcagttccagtatgga
cactacgacaaatgcgtgggactggtgcgagagcacaacaaggacgacatgcagacggtg
gtcaacaccatcttctcgcactctcaggtggccaaaaagaatctgctggtcactctgctc
attgatcacctgtgggccaacgaacctggactaacggacgaattggccaacacgctgagt
gaattgacctccttgaatcgagctgagcactctagggttgctctgcgctcccgccaagtt
cttatcgctgcccaccagccggcctatgagctgcgccacaaccaaatggagtcgatcttc
ctctccgccgttgacatgtacggtcatgacttccaccccgagaacctgcagcgcctgatt
ctgtcggagacctcaatctttgacattctgcacgacttcttctaccactctaaccgggca
gtgtgcaatgctgctctggaagtctatgtgaggagagcttacacatcctatgagctgacc
tgcttgcagcatttggaactctccggtggcctgccgctggtgcatttccagttcctcctc
cccacagctcacccgaacaggctgttctcgcgcatgtcctcccccgatggattggatcag
gcagcggcagagtccttgggaaactcattcgtgcgcaccggagcgatagcagcctttgac
tccttcgaacactttgagatgtactcggacgagattctggatctgctcgaagacttcgtc
tcgccagccatggttaatgccaaggtcctggaagccgtagatgcagcggattccatctcg
gacagccgacacagcacctcgatcaatgtgtccttgtcggatcccgtaacccgggcgaat
gctgccgaggaggccaagtccaccgaaccgattcacattgttagtgtggctgtgagagaa
acgggcgagctggatgacctgcaaatggcccagatctttggaaattattgccaagagcat
aacgaggagctcttccagcgacgcattcgtaggattacatttgctgctctgaagaagcgt
caattccccaagttcttcacgttcagagccagggataagttcacggaggatcgtatttac
cggcatctggagccagcatctgctttccatctggagctgaaccgcatgaagacgtacgat
ctggaggctctgcccacggctaaccagaagatgcacctgtaccttggcaaggccaaggtg
tcgaaaggtcaagaggtcacggactaccgcttcttcattcgctcgatcatccgtcattca
gatctgattaccaaggaagcctctttcgagtatctgcaaaacgaaggagagcgcgtgctc
ctggaggccatggatgagctggaggtggcattctcgcatccgcacgccaagcgcaccgac
tgcaaccacatcttcctgaactttgtgcccaccgtcatcatggatccggctaagatcgag
gagtctgtgacaaagatgattatgcgatatggtccgcgtctgtggaagctgcgtgtactg
caggctgagctcaagatggtcatccgccagtcaccacagtcacccactcaggcagtgcgt
ctgtgcattgcaaatgactccggctacttcctggatatttcgatgtacaccgagcaaaca
gaaccagagacaggaatcattaagttcaaggcctacggtgagaagcagggatctctgcac
ggacatcccatttccacgccctacatgaccaaggacttcctgcagcagaaacgtttccag
gcgcagtccaacggtaccacctatgtctatgatgtgcccgacatgttccgccagatgacc
gagcgtcactggagagaattctccaaggctcgtcccaccgtggacattcgcactccggac
aagattttgatcgagtgcaaggagctggtcctcgagggcgacaaccttgtagagatgcag
cgtctgcccggcgagaacaattgcggcatggtggcttggcgcattgtcttggctactccc
gaatatccgaatggccgtgagatcattgttatagccaacgatctcacctacttgattggt
tcctttggaattaaggaggacgttctgtttgccaaggcttcccaattggctcgccaactc
aaagtaccgaggatatacatctccgtgaacagcggtgcccgcatcggacttgctgaggag
gttaaagctatgttcaagatcgcatgggaggatccagaagagccagataagggtttcaag
tacctttacttgagcaccgaggactatgctcaggtggccaacctgaactcggtgagggct
atcctgatcgaggacgagggcgagcagcgttacaagattaccgacatcatcggcaaggac
gatggcctgggcgtggagaacctgcgctacgctggcttgattgccggtgaaacgtcgcag
gcctacgaggagattgttaccatcgctatggttacctgccgcaccattggcattggatcc
tatgtggtgcgcctgggtcagcgcgttatccagatcgataattcgcacattatactcact
ggctatgctgcgctcaacaagctgcttggacgcaaggtgtatgcctctaataatcagttg
ggtggcacacagatcatgtttaacaacggagtcacccacaaaacagaggccatcgacttg
gacggtgtctacaccatcctcgactggctctcgtacatccccgcatacatcggttgtgac
ctgcccatcgttttgcccagcgatcgcatcgaacgccctgtggacttcatgcccaccaag
tcgccctacgatccgcgctggatgctaggcggccgtgtgaatcctgtgaacgcgaatgac
tgggagaatggattctttgatcgggactcgtggagcgaaatcatggcctcgtgggccaag
acggtggtcactggtcgcgcccgtctaggcggtgtccccgtgggtgtaatagccgttgag
acccgcaccgtagaagtggagatgcccgccgatcctgccaatctcgattcggaagccaag
accctgcagcaggcaggtcaggtgtggtaccccgactcatcgtacaaaacggcacaagca
atcaaagattttggacgagaggagttgccgcttattgttttcgcaaattggcgaggcttc
tccggcggcatgaaggacatgtacgagcaaatcgtcaagttcggagcatacattgtcgac
ggcctgcgggagtacaagaagcctgtgctcatctatctgccgcccaacgccgagctgcga
ggtggagcctgggccgtgctggattccctcattaacccgcgctacatggaaacgtatgcc
gatccggaggccagaggaggtgttctcgagccggagggcattgtggaaataaagtacaaa
gagaaggatctgatcaagacgattcaccgcttggatccgaccaccattgggctgaaaaag
gagctcgatgaggcaaatgcgtctggcgacaaggtcagggctgctcaggtggacgaaaag
atcaaggcccgcatcgctgtgcttatgcacgtctaccacacggtagcagttcactttgcc
gacctgcacgacacgccagagcgaatgctagagaaggagtgtatcagtgagattgtgcct
tggcgcgattcccgccgctggctgtactggcgtctgcgacgtctcctgttggaggacgcg
tatattaagaagatcctgcgcgctcaggacaatctctccgtgggtcaggccaagcagatg
ctgcgtcgctggctggtagaggagaagggtgccacagaggcttatctgtgggacaaaaac
gaggaaatggtgtcttggtatgaggagcagatcaatgccgaatctattgtttctcgcaac
gttaactccgtgagacgggatgccattatttctaccatttcgaaaatgctcgaggactgt
cccgacgtagcgctggacgctgtagtgggtctttgccaaggtctgacgcccgtgaatcgt
ggcgtcgtcgtacgcacactagcccagatgcagctgaatgaggagacctctaacagcaac
cagggatga

DBGET integrated database retrieval system