KEGG   Drosophila sechellia: Dsec_GM21122Help
Entry
Dsec_GM21122      CDS       T01064                                 

Definition
GM21122 gene product from transcript GM21122-RA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dsec_GM21122
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Dsec_GM21122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 422 aa AA seqDB search
MRLFPVRFSAASSSMASLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIR
NRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGG
NPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTTPPLEIQQHSSEPGDNLPIRT
VYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIP
RSQTDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTD
AIIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQSSDMNARQLSATTPKRCDFLQ
DA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgtttccagtccgattctcagccgcctcctcgtcgatggcgagtttggccaaa
atgctcgacttttactcgggcttcaacccctcgcccctctcgataaagcagttcatggac
tttggtcagaatgcttgcgagaagaaatcgtacatattcctgcgcaaggaactccctgtt
cgactggcgaatatcatgaaggagatcgcccttctgccggacaacctgctgcacaccaga
tccgtaagcgaagttagttcctggtacgtcaagagtttcgaggatgtgctggtgtacgag
aaagcagagcccacccacgacaatctgcaaaagtttgtggccgatttggatctcattagg
aatcgtcacaacgatgtggtgcaaacgatggcccagggtgtgatcgaaatgaaggagaac
gagggcggccaggtggatgcgcccacagagagttccattcagtactttctcgacaggctc
tacatgtctcgcatcagcattcgaatgctgataaatcagcacacccttctctttggcgga
aatccacatgcgggtggccgccacattggttgcctggatcccgcctgtgatctctcggat
gtggttcgcgatgcctacgagaatgcgcgattcctgtgcgatcagtactacctgaccact
ccgccgctggagatccagcagcacagcagcgagcctggagacaacctgcccatccgcacc
gtgtacgtgccctcgcacctgtactacatgcttttcgagctctttaagaactctatgcgt
gctgttgtggagcaccatggccatgacaacaatgacacattgccccccttgaaagtagcc
atctgcaagggcaaggaggacatctgcgtgaaaatttctgaccagggcggcggcattccc
cgctcccagaccgatcagctcttcaaatatatgtacagcacagcgccgcagccctcgaag
tcggatctgcacacggtgccactagcgggctatggatacggtctgccgatctcaaggctt
tatgcccgctatttccacggcgacattgtgctgctgtcctgcgagggatttggcacagat
gcaatcatctatctaaaggctctgtccgacgaagcaaacgaattgctgccgatcttcaac
aagacaagctcaaagttctatcgcgccaccgtgcccacgggtgactggtcgaatcagagc
tccgatatgaacgcacgccagttgtcggccaccacacccaagcgctgcgactttctccag
gacgcatga

DBGET integrated database retrieval system