KEGG   Drosophila sechellia: Dsec_GM21133Help
Entry
Dsec_GM21133      CDS       T01064                                 

Definition
GM21133 gene product from transcript GM21133-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dse  Drosophila sechellia
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsec_GM21133
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dsec_GM21133
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsec_GM21133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 515 aa AA seqDB search
MARRFILLLVLAVCLSGSASGQRDHPRGRSIDAESHPIKHAEEQQTQYWVDKAQAKLLSK
LAEQPSATTNKAKNVILFLGDGMSVHTVTATRNLLGDSAEQVYFEGFPYTGLSKTYCVNR
QVADSACTATAYLGGVKANYGTIGVNANVSRYSCDGAANEEDQVHSIAQWAQAAGKDAGL
VTTARVTHASPAGVYAHIADRNWENDWEVANRECDPEQTIDIARQLVEQPVGQQLKVILG
GGRKNFIDATVNDEEGYPGQRTDGRHLIRSWLDQKKEANVSAKYVWSRKGLRLVDLENTD
YLLGLFANDHLPYNGDRDRKRSQLADPSLSELTEAAIKVLSRNDKGFFLFVEGARIDMAH
HDTFAKRSLEDTAEFARAVQKARELTSEDDTLIVVTADHAHVMSINGYPYRDQEITGLAQ
LADDNLPYTILSYANGPGYYSAYNRAEGRALLKEKLVADSDYQYPTLAPLDAETHGGDDV
AVYASGPYAQYFSGNYEQSNIPALMARAAGIGPYA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccaggagattcattctgttgctcgtcttagctgtctgcctgagcggaagtgccagc
ggacaaagagaccatcctcgtgggcgttccattgatgccgaatcgcatcccatcaagcat
gcagaggagcagcagacccagtactgggtggataaggcccaggcgaagctgttatcgaag
ctggccgagcagccgtccgcgaccacaaacaaggcgaagaacgttattctgttcctgggc
gatggaatgtccgttcacacggtcacggccacccggaatctgctgggcgacagtgcggag
caggtgtacttcgagggatttccctacactggcttgtccaagacctactgcgtgaaccgc
caggtggccgattccgcctgcacggccaccgcctatttgggcggtgtgaaggcaaactat
ggaaccattggcgtgaacgccaatgtgtccagatacagctgtgatggcgccgctaacgag
gaggatcaggtgcacagcatcgcgcagtgggcacaggcggctggcaaggatgcaggtctg
gtgaccacagcccgggtgactcatgcatcaccggctggcgtttatgcccacatcgcagat
cgcaattgggagaacgactgggaggtggccaacagggagtgcgatcccgagcagaccatc
gatattgcccgccagctcgtggagcagcctgtgggtcagcagctgaaggtaatccttgga
ggcggtcgcaagaacttcatcgacgcaacggtgaacgatgaggagggatatcccggccag
cgtaccgacggtcgccacttaatccgcagctggttggatcagaagaaggaggccaatgtc
tcagccaaatacgtgtggagtcgcaagggactccgtctggtggatctcgagaatacggac
tacctcttgggtctttttgccaatgaccatctgccgtacaacggtgatcgggacaggaaa
cgtagtcagttggcggatccttcgctgagtgagctcacggaggctgccattaaggttttg
agtcgcaatgacaagggattcttcctcttcgtcgagggtgctcgtatcgacatggcccac
cacgataccttcgccaagagatccctcgaggatacggctgagtttgcgagggccgtccag
aaggcacgcgaacttacctccgaggatgacacactgatcgtggtgaccgctgatcatgct
catgttatgtccatcaatggttatccttatcgtgaccaggagataaccggattggcacag
ctggcggatgataatctgccctatacgattttgtcctatgccaatggacctggctactac
tccgcctataatcgtgctgagggacgtgcccttctaaaggagaagttggtggcggactca
gactaccagtatcccacgctggcgcccttggacgcggaaacccacggaggagacgatgtg
gcggtgtacgcctcggggccctatgcccagtacttcagcggcaactacgagcagagcaat
attccggcgctgatggccagagcagcgggtatcggtccctatgcctag

DBGET integrated database retrieval system