KEGG   Drosophila sechellia: Dsec_GM21149Help
Entry
Dsec_GM21149      CDS       T01064                                 

Definition
GM21149 gene product from transcript GM21149-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dse  Drosophila sechellia
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dse01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dse00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dse04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 314 aa AA seqDB search
MISVCFSRCSCILYFVLLIVAFVLGYIWWGPTKGGTNPDVLPVVLWHGMGDTCCVPFSLG
GIMSLIVEQTKGGYVRSLEIGGNVVMDWESGFFIHPNEQVDYVCKQLLQDEHLAKGYHAI
GFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFGLPMCPTLTEASCDYITRLLDNAAY
APVVQRSLVQATYWHDPIMENKYRLGSTFLSDINNELYINEFYIENLHKLKKFVMVQFLN
DTIVQPKESQWFQYYTTGQNKVIQPFTESKVYKDLGLDKMHRQGKLVFLGVEGDHLAISK
AWFIKSIVPLLLEK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgtctgcttttctcgttgttcatgcattttatattttgtgctcctgatcgtg
gccttcgtgcttggctacatatggtggggcccgacgaaaggaggaaccaatccggacgtc
ctgccggtcgtcctgtggcacggaatgggcgatacctgctgcgtgcccttcagcctgggt
ggcattatgagcctgatcgtggagcagacaaagggcggctatgtgcgatccctggagatc
ggcggcaatgttgtgatggactgggagagcggctttttcatacatcccaacgaacaggtg
gattacgtttgcaagcaactactgcaggatgagcacctggccaagggataccacgccatc
ggattctcgcagggcggccagtttctgcgcgcggtggccgaacgttgtccgaatccgcca
atgaggaacctcatcaccctcggtggacagcaccagggcatcttcggactgcccatgtgc
cctaccctaaccgaagcgtcctgtgattacatcaccaggctacttgacaatgccgcctac
gcacctgtagtgcagaggtcattggttcaggccacctactggcacgatccgatcatggag
aacaaataccgcctgggcagcacatttctctcggacattaacaatgagctctacatcaac
gagttctacattgagaacctgcacaagcttaagaaatttgtgatggtgcagttcctaaac
gacacgattgtccagccgaaggagtcccagtggtttcaatactacaccactgggcagaac
aaagtcatccagccctttactgagagcaaagtctacaaggatttgggactggacaagatg
catcgacaaggaaagcttgtctttctcggcgtcgaaggtgatcacttggccatatccaag
gcctggtttatcaagagcatagtgcctcttctactcgaaaaataa

DBGET integrated database retrieval system