KEGG   Drosophila sechellia: Dsec_GM21187Help
Entry
Dsec_GM21187      CDS       T01064                                 

Definition
GM21187 gene product from transcript GM21187-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dse  Drosophila sechellia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsec_GM21187
   01230 Biosynthesis of amino acids
    Dsec_GM21187
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM21187
   00030 Pentose phosphate pathway
    Dsec_GM21187
   00051 Fructose and mannose metabolism
    Dsec_GM21187
   00052 Galactose metabolism
    Dsec_GM21187
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dsec_GM21187
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsec_GM21187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 950 aa AA seqDB search
MHSIKFRVFTKLKPLFLEINGRIPKCRHFHGPSTFRLQISNKTPPIRQKLTFPNIGFQCT
RSLHLCSPRDISGSNLLSVKFNCKRHVIKLRSDSGDKKNDSPGDKNKKKDKSAQRCGKPI
NNLHSGFLNAKNYSEKNAMKKKKRAPKKKCGKTVDELRKCLRTMQDVIDFVHPVKPFKDK
GLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVSSI
IHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLL
DELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTA
YSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVDWPDRLCSQLAQERSAGQR
LNIVIVAEGAMDREGHPITAEDVKNVIDERLKHDARITVLGHVQRGGNPSAFDRILACRM
GAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLRGR
SFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYR
GDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKEFK
IQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLNEI
TEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQDV
YHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGSPT
PFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDLIA
ETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaataaaatttcgagtatttaccaaattaaaacccttatttttggaaatcaat
ggacggatacctaaatgccgccattttcatgggccttcaacatttcgattacaaatctca
aacaaaacacctccgattaggcaaaagctcacatttccaaacatcggattccaatgcaca
cgaagtcttcatttgtgtagtcctcgagatatttcaggaagtaatcttttaagtgtaaaa
tttaattgcaaacgacatgttataaagttgcgcagtgattctggtgataaaaagaatgac
agtcctggtgataaaaacaaaaaaaaagacaagtctgcgcaacgatgtggaaaaccaata
aacaatctgcacagcggatttctcaatgctaagaactattctgaaaaaaatgctatgaaa
aagaaaaagcgtgctccaaaaaagaaatgtggcaaaacggtggatgagctgcgaaagtgt
ttaagaaccatgcaggatgttattgattttgtacatccagtcaagccttttaaggacaaa
ggactggcggtcttcaccagcggcggggattcccagggcatgaatgccgccgtgcgagcc
tgtgtgcgtatggccatctatttgggctgcaaggtctacttcatccgtgaaggctaccag
ggcatggtggatggaggcgactgcatccaggaagccaactgggcctcagtctcatccatt
atccatcgtggtggcaccatcattggctccgcccgttgccaggacttccgtgagcgtcag
ggtcgcttgaaagccgctaacaacctgattcagcgaggaatcaccaatctggtggtcatc
ggaggtgatggctcccttacgggcgccaatctgttccgacaggagtggtccagcctgctg
gacgagctggtcaagaacaagaccattaccaccgagcagcaggagaagttcaatgtcctg
cacatcgttggattggtgggctccatcgataacgatttttgcggcacggacatgaccatc
ggcacggatacggcactgcatcgcatcatcgaggccatcgatgccatctccagtaccgcc
tactcccatcagcgcaccttcatcatggaggtcatgggtcgtcattgcggctatttagct
ctagtgggcggactggcgtgcgaggcggatttcatattcattcccgaaatgccgcccaag
gtcgattggccagacaggctctgctctcagctggcccaggagcgatctgctggccagcgt
ctgaacatcgtgatcgtggccgagggagccatggatcgcgagggtcatcccatcacagcc
gaggatgtgaagaatgtgatcgacgagcgtctgaagcacgatgcccgcatcactgtcttg
ggtcacgtgcagcgcggtggcaatcccagtgccttcgatcgtattttggcttgccgcatg
ggagctgaggccactttggccctgatggaggccaccaaggactcggtgccagtggtcatc
tctctggacggcaaccaggcggttcgcgtgccgctgatggagtgcgtggagcgcacccag
gctgtggccaaggccatggcggagaaacgctgggcggatgctgtcaagctgcgcggacgc
tccttcgagcggaatctggagacctacaagatgctgacgcgcttgaagccgcccaaggag
aacttcgacgccgatggcaagggaatcgagggttaccgcctagctgtgatgcacattggt
gctccggcttgcggtatgaatgcagctgtgcgcagcttcgtgcgcaatgccatctaccgc
ggtgatgtggtttatggaatcaacgacggtgtcgagggcctgattgccggaaatgtccgc
gagctgggatggtccgatgtctcaggatgggttggtcagggtggcgcctacttgggcacc
aaacgcacactgcctgagggcaagttcaaggagatcgctgctcgtctcaaggagttcaag
atccagggtctcctgatcatcggtggctttgagagttaccatgccgccggacagatcgcc
gatcagcgggacaactacccgcagttctgcatccccattgtggttattccatcgacgatc
tcgaacaatgtgcccggcacagaattttcactgggatgtgacaccggtttaaatgagatt
acggagatttgcgaccgtatccgtcagtcggcccagggcaccaagcgccgagtgttcgtc
atcgagacgatgggtggctactgtggctatttggccaccctggccggtttggccggtgga
gctgatgccgcctacatctacgaggagaagttctccatcaaggacctgcagcaggatgtc
tatcacatggcctccaagatggccgagggcgtctcccgcggtctgatcctgcgaaacgag
aaggctagtgagaactacagcacggacttcatttaccgcctgtactcggaggagggcaag
ggcctcttcacctgccggatgaacatcttgggtcacatgcagcagggcggctcacccact
cccttcgaccgcaacatgggcaccaaaatggccgctaagtgtgtcgactggctggccacc
cagatcaaggcgaacatagacgccaacggagtggtcaactgcaagtccccggacaccgcc
acgctgctgggaatcgtgtcgcggcagtaccgcttctcaccactggtcgacctcattgcc
gagacgaactttgatcaacgcatcccgaagaagcagtggtggctgcgcctgcgtcccctg
ctgcgcatcctggccaagcacgattccgcctacgaggaggagggtatgtacatcaccgtc
gaggaggagtgtgacaccgacgccgtcgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system