KEGG   Drosophila sechellia: Dsec_GM21324Help
Entry
Dsec_GM21324      CDS       T01064                                 

Definition
GM21324 gene product from transcript GM21324-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dse  Drosophila sechellia
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsec_GM21324
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dsec_GM21324
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsec_GM21324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 596 aa AA seqDB search
MSNGRYGRFGALIGVACVSSTHCRFLIYSTKNAEVLAYHELKLRQIVHQAGWMEYDPSEI
WKNTQECIETAYKNLVILEINPRDIIAIGIVNQRGTSVLWNLETGQPLHNAIGWSDCRST
PILKTLLHNVRHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPAVATAIEENKCLFGTLDS
WLLWNLTGGVEMGVHSTDLTNAHYTSLMNVSTEQWDPKLCQLFRVPLNILPRIRSNSEIF
GYVLEGPLHGTPIAAMMGEQPASLLGQLCVKAGQNVCSLDDSCFVLLNTGREKLDSANGL
ITGIAHKLGEKEATNYTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTFIGENS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGLYAPYWRHDARGIILGLTSQTTSENITQ
AAYEATGFQIFEVLQAFKRDTPNWDRSCMQPVLTFGGDYAENSHLVQFIADIIGYMLERP
QTTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVFSPTTTKNRRELLYKRWDYAVKKC
LHWNNYETYEADIELFAQRELDPNLPVRRSVPGSIFLTTSFAMILLANYLMINPLK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgggcgctacgggagattcggagctctcatcggcgtcgcctgcgtgagcagc
acccactgccgctttctgatatactcaacgaaaaatgccgaggtcctggcctaccatgag
ctcaagctgcgacagattgtccaccaggcgggctggatggagtacgatccgtcggagata
tggaagaacacacaggagtgcatagagaccgcctataagaacctggttatactggagatc
aatccacgtgatattattgccattggtatcgtaaatcagcggggcacctcggtgttatgg
aatttggagacgggacaaccgctgcacaatgccatcggctggtcggattgccgcagcact
cccatcctgaagaccctgctccataatgtccggcacaatgtggactacgtgaggtatcgc
agtggcttgcccctgagcagctgtttcagtgccctaaagatccgttggctgatggatcac
gttcctgccgtagccactgccattgaggagaacaagtgcttattcggcaccttggactcc
tggcttctgtggaatctcaccggcggcgttgagatgggggtgcactctactgaccttacc
aatgcccactacacctcccttatgaacgtgtccacagagcaatgggatcctaaactctgc
cagctctttcgagtgcccctgaacatactgccacggatacgatccaactccgaaatcttc
ggctatgtgctggagggtcctttgcatggcacccccatagcggccatgatgggtgagcag
cccgcaagtttgttgggccaactctgcgtgaaggccgggcaaaatgtgtgcagcctggac
gatagctgtttcgtgctccttaacacgggcagggagaagctggactctgcaaacggactg
ataacgggcatagcgcacaagctgggcgaaaaagaggccactaactacacactcgaggga
gccatttcaaatgccggttccacggttacatggctgcgggataagctacagataaatact
gagattaattccaatgataacgtggtggagtctttaaatacattcatcggcgagaactcg
atgatctcgtcctcttgttcctcatccatgctgaatgccgagtgtggtctggcggccaag
aggtcggaaattacatttgtgccggcatttcatggcttgtacgctccctactggcggcac
gatgccaggggcataatcttgggacttaccagccagaccacatcggaaaacattacccaa
gcagcttacgaggccaccgggttccagatctttgaagtgctacaggcgttcaagcgcgat
acacccaactgggaccgatcctgcatgcagcctgtgctgacattcggcggtgattacgcc
gaaaactcgcatttggtgcagttcatagcagatattattggctacatgctggagcgacca
cagaccacctcacctgctggcttgggcgttatgataaccgcgggcgtgacgatgaaagtg
gtgtccctggagcatgccgtaaaaatgtacactccgcccactgatgtcttttcgccaaca
actaccaaaaatcgacgagagctgctctacaagcgctgggattatgcggtaaagaaatgc
ctgcactggaacaactacgagacgtacgaggctgatattgaactgtttgctcagcgagaa
cttgatcccaatttacctgttaggcgttccgtaccgggcagtatattcctgaccacgtcg
tttgcgatgattctcctggctaactacttaatgatcaatcccctgaaatag

DBGET integrated database retrieval system