KEGG   Drosophila sechellia: Dsec_GM21447Help
Entry
Dsec_GM21447      CDS       T01064                                 

Definition
GM21447 gene product from transcript GM21447-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dse  Drosophila sechellia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsec_GM21447
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dsec_GM21447
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsec_GM21447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 673 aa AA seqDB search
MAEAKDIEKLFETDGYLRPFEHEIRRRHGVLEDWLNKINQSEGGLDGFSTAYKHYGLHFQ
PDNSVVAREWAPGARDVYLTGDFTRLWQVGASPATQRGRQSGHQALERIKIIIRNHSGQL
LDRLSPWAKYVVQPPKSANQGVNYKQYVWEPPSYERYQRQHPGPPRPKSLRIYECHVGIA
SQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFGYQVTSFYAASSRYGNPE
QLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGARGEHSLWDSRLF
NYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSGDYNEYFGLNVDT
DALNYLGLANHLLHTIDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRLGMAIPDKWIELL
KEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLMDKEMYTHMSTMS
DPSLIIDRGLALHKVIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVGNNDSYHYARRQW
NLVDDDLLKYKYLNEFDRAMNETEERYGWLHSGPAWVSWKHEGDKIIAFERAGLVFVFNF
HPQQSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDANCKHPSNPEGYAGRSNFIEVYT
PSRTAVVYARVSD
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctaaggacatcgagaagctgttcgagacggacggctacttgcggccgttt
gagcacgagattcgtcgtcgtcatggcgtgctcgaggattggcttaataagataaaccaa
agcgaaggcggactggatggcttttcgacggcttacaagcactacggacttcacttccag
ccggacaattcggtagttgcccgcgagtgggcacctggagcgagagatgtctatctcacg
ggtgacttcactcgactttggcaagtgggagcttcacctgccacccaacgaggacggcag
tccggccatcaagcacttgagcgaattaagattatcattcgcaaccattccggtcaattg
ctggaccgcctgtcgccctgggccaagtacgtggtgcagccgccgaagtcggccaaccag
ggggtcaactacaagcagtacgtgtgggagccaccgtcctacgagcgttaccaacgccag
catccgggtccgccaaggcccaaatcgctcaggatctacgagtgccacgtgggtattgcc
tcccaggagccgcgggtcggcagctacgacgagttcgctgatcgcatcgtgccgcgcatc
aagcgtcagggctataactgcatccaggttatggccatcatggagcacgcctactacgcc
agtttcggctatcaagtgaccagcttctatgctgcctccagccgttatggcaacccggag
cagctgaagcgcatgatcgacgtggcccactcgcacggccttttcgttctgctcgatgtt
gttcactcgcatgcttctaagaacgttcaggacggtctgaaccagttcgatggcaccaac
agttgcttcttccacgacggagctcgtggcgagcactcgctgtgggacagtcgtctcttc
aactacgttgagtacgaggtgctgcgctttttgctatccaacctgcgttggtggcacgac
gagtacaacttcgatggctatcgctttgacggagtaacctctatgctgtaccattcccgt
ggcattggggagggcttcagcggcgactacaacgagtactttggcctgaacgtcgacacg
gatgccctcaattatctgggactggccaatcatctgctgcacaccatagattcaaggatt
ataaccattgcagaggatgtttctggaatgcctaccttgtgtcgccccgtatcagagggt
ggtatcggattcgactaccgcctgggtatggccatcccagacaagtggatcgaactgctg
aaggagcagagtgacgacgagtgggacatgggcaacttggtgcacacgctgaccaaccgt
cgctggatggagaacacagtggcctacgcagagtcccacgatcaagcgctagtgggcgac
aagacgatcgccttctggttgatggacaaggagatgtatacgcacatgtcgacgatgtcg
gacccctcattgatcatcgaccgaggactggcgctgcacaaggtgattcggctgatcacg
cacgccctgggaggcgaggcgtacctgaactttatgggcaacgagttcggacatcccgaa
tggctggactttccgcgcgttggcaacaacgattcgtatcactatgctcgtcggcagtgg
aatctcgtggacgacgatctgctgaagtacaagtaccttaacgaattcgatcgagccatg
aacgagaccgaggagcgctacggctggctgcattccggacccgcttgggtcagctggaag
cacgagggcgacaagataatcgcattcgagcgagccggactggtgttcgttttcaacttc
catccccagcagagtttcaccggataccgagtgggcaccaattgggcgggcacctaccag
gcggtgctctcctcagacgatcctctattcggcggccacaaccgcatcgatgccaactgc
aaacatccctccaatccggagggctacgccggtcgctccaatttcattgaggtctacaca
ccctcacgcaccgccgtggtctatgcccgcgtcagtgactag

DBGET integrated database retrieval system