KEGG   Drosophila sechellia: Dsec_GM21521Help
Entry
Dsec_GM21521      CDS       T01064                                 

Definition
GM21521 gene product from transcript GM21521-RA
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM21521
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsec_GM21521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 979 aa AA seqDB search
MTLSPNTNQHNTHVEHRNRTIHSSQGHKLANGYVMEDPRSSRCHDKLFSGSLKSLALRED
SNASDSEVTDTAKGSGTGLVGLQNIANTCYMNSALQALSNLPPMTHYFINCSDLVEYIAE
QSARRCKPGGLAKSYRRLMQDIWQDVDDPKEFIAPRGILYGIRTVHPMFRGYQQHDTQEF
LRCFMDQLHEELTEQVSMMPHTQNQPQYPTLQQQQPSETDDENDDEAAPASLSPASESEY
DTCESSMSERSAEVLLKTEYFVTPCRTNGSNSGLPEGHSVQLQQPPMQHQQKNSSSAEQK
PIEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVLHQTHSLSV
QSLNAAETSARTNEGWLSWMWNMLRSWIYGPSVTLYDCMASFFSADELKGDNMYSCERCN
KLRTGIKYSRVLTLPEVLCIHLKRFRNDLSYSSKISSDVYFPLEGFDMRPYIHKDCKSEV
AIYNLSSVICHHGTVGGGHYTCFARNALNGKWYEFDDQFVTEVSSEVVQSCQAYVLFYHK
HNPQMKLVRDEAMTLSTSHPLCDSDIQFYITSEWLSRLATFSEPGPINNQEMLCPHGGIL
HSKADVISQIAVPISQPLWDYLYRTFGGGPAVNIIFECEICKRAAETLSRRQQYELNEFT
KYNGLQNEFDSTAIYAIAMPWLRSWQQFSRGKTHKDPGPITNEGIAAPTENGSQNGSATV
SCVRLGSDYAQLNARLWRFLHNIYGGGPEIILRQALSDEDDAEEIEIIDQDDECDDDEDQ
DQDLEGEDEEIAAASYQHNHSDTESNLGIRTTPSPSLSTSPSPSPTGTRQPTEAESDLRP
NSPKSKHSRSKMKVSALRLNMRNKGRRNRSAFNQYAEMFGAKGNYNAHSNSEPVVSEKNE
KDTDNDRTVAFPSEYSLPILIPFQSDNFQVNGVHEKSRDKGKLRNSSKSGSTAATKENVT
LQKFVTLREANGLSDETDI
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgactttgagtcccaacacaaatcagcacaatacacatgtagagcaccgcaaccgcacc
atacacagcagccagggccacaagctggcgaacgggtatgtcatggaagatccaaggagc
agccgatgtcacgacaaactcttcagcggatcgctaaaatcgctggcactccgcgaggac
tcgaacgccagtgacagtgaggtcacagacacagcgaagggctcgggcacgggactcgtg
ggcctgcagaacattgcgaacacctgctatatgaattcggcactacaggcactgagtaat
ttgccgccgatgacacactactttatcaactgcagcgaccttgtggagtacatagcagag
cagagcgcccgtcgctgcaagcccggcgggctggccaagagctatcgccgcttgatgcag
gacatctggcaggatgtcgatgatcccaaagagtttattgcccctcgtggaattctgtat
ggcattcgcacggttcatcccatgtttcggggctatcagcagcacgatacccaggagttc
ttgcggtgcttcatggaccagctgcacgaggagctgacagagcaggtctcaatgatgcca
catacgcagaatcagccgcaatacccaacacttcagcagcagcagcccagcgaaacggat
gacgaaaacgatgatgaggcagcgcctgcgtccttgtcgcctgcatccgaaagcgagtac
gacacctgtgaaagcagcatgtcagagcgatcggccgaggtgctgctgaagacggagtac
tttgtaacgccctgtcggacaaatggttccaacagtgggctaccagaaggccactcggtg
caattgcagcaaccaccgatgcagcatcagcaaaaaaattcttcctccgccgaacagaaa
cctatagaagcagcgcgctcaataatcagcgacgtgttcgatggcaagcttttgtcctcg
gtgcagtgcctgacctgcgatcgtgtgtccacgcgcgaggaaacattccaggacctctcg
ctgcccattcccaatcgtgattttctcaacgttcttcaccaaacccatagcttaagcgtg
caaagtttgaatgccgctgaaacctccgctaggaccaacgagggctggctgtcctggatg
tggaatatgctgcgctcctggatttatggaccttcggtgacgctctacgactgcatggcc
agttttttcagcgcggatgagttgaagggagacaacatgtacagctgcgaacgctgcaat
aagcttcggacgggaataaagtactcccgcgtcctcaccttgccagaggttttgtgtatc
cacctgaagcggtttcgcaatgatctttcttatagttcaaaaatctcctcggacgtttac
tttccgctggagggcttcgacatgcggccgtacattcacaaggattgcaagagcgaggtg
gccatttacaacctgtcgtcggtgatttgccatcatggaacagtgggtggtggccattat
acttgcttcgctcgcaatgcgctcaacgggaagtggtatgagttcgatgatcagtttgtg
acggaggtttcttcggaggtggtgcagtcctgccaggcgtatgtccttttttaccacaaa
cacaatccccagatgaagctagtcagggatgaggcgatgactttgtcgacttcacatccc
ctgtgtgattcggacattcagttttatataaccagcgaatggctctcaagattggccacc
ttttcagaaccaggacctattaacaaccaggagatgctgtgcccccatggcgggattttg
cattccaaggcggacgtaatcagccagattgcggtgccaatttcccagccgctatgggac
tatctctaccggactttcggcggcggaccagctgtgaatataatattcgagtgcgagatc
tgcaagcgggcagcggagaccctttcccgtcgtcaacaatatgaacttaacgagttcaca
aaatacaatgggctgcagaacgaatttgattcgaccgccatttatgcgatcgcaatgcca
tggctgcgctcctggcagcagttttctcgcggaaaaacccacaaggatccgggaccgatc
accaacgagggcatcgctgctcccaccgaaaatggttcccaaaatggaagtgccactgtg
agctgcgtgcgattgggctcggattatgcccaactgaatgcgcgcttgtggcgattcctg
cataacatctatggtggtggtccggaaattatacttcgacaggccctatcagatgaagac
gatgccgaggaaatagaaatcatcgaccaagatgatgagtgcgacgatgatgaggatcag
gatcaggatttggaaggggaagacgaggagattgcggcagccagctatcagcacaatcat
tccgacaccgaaagcaatttgggtattcgcactaccccgagtccaagtctcagtaccagt
cccagtccaagcccaaccggcacgcgtcagccgacggaggcggagtcggacctgcgacca
aatagtccaaagtccaagcacagcaggtccaaaatgaaggtatccgccctgcgattgaat
atgcgaaataagggcaggcgcaatcgcagtgcgttcaaccagtacgccgagatgtttgga
gccaaaggaaactacaatgcccacagcaattccgaacccgtggtgtctgagaaaaatgag
aaggatacggacaatgaccgtactgttgcatttccgagcgaatacagcttacccattttg
ataccattccaaagcgacaatttccaggtgaacggtgtgcacgagaagtcacgcgacaag
ggaaaactgcggaatagttcaaaaagcggcagcactgctgccaccaaggagaacgtcacg
ctgcaaaagttcgtgaccctgcgcgaggccaatgggcttagtgacgagactgatatttga

DBGET integrated database retrieval system