KEGG   Drosophila sechellia: Dsec_GM21777Help
Entry
Dsec_GM21777      CDS       T01064                                 

Definition
GM21777 gene product from transcript GM21777-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dse  Drosophila sechellia
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dse00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dse00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dse00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dse00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dse00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dse04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 622 aa AA seqDB search
MRFSGYNRYQCFCSAVASMLLLSLLSFAVGAALTRADDVGSDADAGSASRKWLCSRTDIC
TAEGEMVTGLQYAPDIFESQRDCRLSCGKYGAIWPMPTGKECTISHRRVRFDPWKVRFHV
VAPGEAATQFLRETNRLFVSNLLKECIRNCTLETSKQILVRSTVANESLVLDWPTDESYA
LVVRTTETATFVDIQATTVYGARHAFETLSNLVTGSLSNGLLMVTTANITDRPAFSHRGV
LLDTARNFVPLKFIRSTLDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQRYGAYSSSQT
YSRQDALNLVKYARLRGIRILIEIDGPSHAGNGWQWGPAAGLGNMSVCLNQSPWRRFCVQ
PPCGQLNPLNDHMYAVLKEIFEDVAEVGAPEETLHMGGDEVFLPCWNNTDEIRDGMRARG
YDLSEQSFLRLWSQYHQRNLNAWDEINERMYPGIKEPKSVIIWSSHLTNPRYIEAYLPKE
RFIIQTWVESQDALNRELLQRGYRLIVSTKNAWYLDHGFWGSTSYYNWRTVYSSGMPLGR
SKDQVLGGEVCMWSEFVDQNSLESRIWPRAGAAAERMWSNPKSSALLAQRRFYRYRERLL
ARGIHADAVIPHWCVLHEGQCL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcagcggttacaatcgttatcagtgcttctgctctgccgttgcatcgatgctg
ctattatccttattatccttcgcggtcggcgcagcgctgacgcgggcagatgacgtcggc
agcgacgccgacgccggcagcgccagcaggaaatggctgtgcagccggacggacatctgc
accgcggagggcgaaatggtgaccggactgcagtacgcaccggatatcttcgagagccag
cgggactgccgactgtcgtgcggcaagtacggagccatctggcccatgcccaccggcaag
gagtgcaccatatcgcacaggcgagtgcggttcgatccgtggaaggtgcgtttccatgtg
gtggcgcccggcgaggcggctacccagttcctcagggagacgaaccggctgttcgtctcg
aatctgctgaaggagtgcatacgaaactgcacgctggagaccagcaagcagattctggtc
aggtccacggtggccaacgagagcctcgtcctggactggcccaccgacgagagctacgcc
ctggtggtgcgaaccacggagacggccacatttgtggacatccaggcgacaacggtgtac
ggagcacgtcatgctttcgagacgctgagcaacctggtcaccggcagcctgtccaatggc
ctgctgatggtcaccacggccaacatcaccgatcgtccggccttttcgcatcgcggcgtg
cttctggatacggcccgtaactttgtgccgctcaagttcatacgcagcaccttggatgcg
atggcggccagtaagctgaatgtgctccactggcatgtggtggacacgcacagttttcca
ctggagatcaccagggtgccggagatgcagcgttacggagcgtactcctcatcgcagacg
tactcgcgccaggatgcactgaatctggtcaaatatgcccgactgcggggcatacggata
ctgatcgagatcgatggaccctcgcatgcgggcaatggctggcaatggggtcctgccgcc
ggactgggcaacatgtccgtgtgcctgaaccaatcgccctggaggagattctgtgtgcag
ccaccgtgcggccaactgaatcccctgaacgatcacatgtacgcggtgctcaaggagatc
ttcgaggacgtagccgaggtgggcgctcccgaggagaccctgcacatgggcggcgacgag
gtgttcctgccctgctggaataacaccgacgagattcgagatggcatgagggcacgcggc
tacgatctcagcgagcagagcttcctgcggctgtggtcgcagtaccatcagcggaacctc
aatgcatgggacgagattaacgagcgtatgtatccgggcatcaaggagcccaagtcggtg
atcatctggtccagccacctcaccaatccccgctacatcgaggcctacctgcccaaggag
cggttcataatccagacctgggtggagtcgcaggatgccctcaatcgggagctcttgcag
cggggctaccgactgattgtgtccacgaagaatgcctggtacctggatcacggcttctgg
ggcagcacatcgtactacaactggcgcaccgtgtactccagtggcatgccccttggtcgc
agcaaggatcaggttctcggcggtgaggtgtgcatgtggagcgagtttgtggatcagaac
tcactggaatcgcgaatctggccgcgagctggtgcagcagccgagcgaatgtggtctaat
ccgaagtcttctgccctgctggcccaaagaaggttctaccgctaccgggagcgactcctg
gcccgcggaatccatgcggatgcagtaattccgcactggtgcgtcctccacgaaggacag
tgcctctaa

DBGET integrated database retrieval system