KEGG   Drosophila sechellia: Dsec_GM21793Help
Entry
Dsec_GM21793      CDS       T01064                                 

Definition
GM21793 gene product from transcript GM21793-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dse  Drosophila sechellia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM21793
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dsec_GM21793
Translation factors [BR:dse03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dsec_GM21793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MAKKKSEEQSSADANDSDYQEEPNFEDPPGFVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPVRLEKLKSVINKLFSNYGDIVNVVYPVDEEGKTKGYAFMEYKQASQAEEAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQTFKVQSDLYNFINDPDTYDQYC
VAAETAPNCVQVGFWQNVLPEPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKDLDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGETNSSNVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIITSSPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWADQKSRRIMLR
GHVDTDNLETDEVDEEIVEFLVKEEVTLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagaaaagcgaggagcaatccagtgcggatgcgaacgacagcgattaccag
gaggagccgaactttgaggatccgcccgggttcgtggacaacattagtgatgaagatctg
ctgggcgatatgctggcccagcgcccctcggaggccgatggcgtcgagagtgtggtggta
gtggacaacatcccgaaggtggagccggtgcgcctggagaagctgaagtcggtcatcaac
aagctgttttcgaactacggagacattgtcaatgtggtctatcccgtcgacgaggagggc
aagaccaagggctacgccttcatggagtacaagcaggccagccaggcggaggaggccgtc
aagaagctcaacaatcatcgcctagacaaaaaccatacctttgccgtcaatcttttcacc
gatttccaaaagtatgaaaacatccccgagaagtgggagccgccaaccgtgcagaccttc
aaggtgcagagcgatctatacaacttcatcaacgacccggacacttatgaccagtactgc
gtggcagcggagactgcgcccaactgcgtgcaggttggtttctggcaaaacgtattgccc
gaaccctttgagctggagacccgcgaacgcttcaccgacaccttcgtcaagtggtcgccc
ctgggtacttatgtggtcaccttccacaaacccggcgtagccatctggggtggcagtagc
ttccagaagatccagaagttcccccatcctggcacccaattcgttgagttttcgccctgc
gagaattacctggtgacctacgggcccacacccacgggccaaaagatcatcatctgggac
attcgcaccggagccgagaagcgttcgtttgttgccgatggcatgtcggtcctttccatg
ttccgctggtcgcacgacgacaagtttgtggcccgcatgggcgagaattcgatccacatc
tacgagacaccctctttctatcttctggacctgaagtccatcaagattcccggcattcgc
ggcttctcgtggtcccccacagacaacgtgatcgcctactgggtggaggagcagaaccaa
atacccgcccgcgttaccctgatggagatccccaagaagcgtgagatccgtaacaagaac
ctcttccatgttgccgactgcaagcttcattggcaaaagtccggcgactatctgtgcgtt
aaggtggatcgctactcaaagttaaagaaggacaagaaggacctggacgtcaagtttctg
ggcatgttctacaactttgagatcttccacatgcgcgagaaggagattcccgtcgactct
gtggagattcgcgagctcattctggcctttgcctgggagcccatcggcaacaagttctcc
atcattcacggcgagaccaactcatcgaatgtgagcttctacgaggtgaacaagggtgtg
aagcccagcttggtgaagcgtctggaaaagaagtcctgcacgcatctgttctggtcgcca
cgcggtcagtttatcgtgatggccaacctcaccatgggtaccttcgagtttgtggactcc
accaacgattacatcatcacgtcgtcgcccgatcatttccgcgcttccgaggtcgagtgg
gatcccactggacgctacgttgtgactggtgtctcgtcatggaaggtgaaggaggacacc
ggcttcaacatgtacacgttccagggccgcatcatcaagcgtaccatcctcaagaacttt
gtgcagttcttgtggcgcccgcgtcctcccaccctgctcagcgaagagaagcagaaggag
atcaagaagaacttgaagaagtactacgctgccttcgaacaaaaggatcgcctgcgcctt
acccgtgcctccaaggagctgctcgagaagcgctcgcagctgcgcgagacctttatggag
taccgcaacaagcgtatcgccgagtgggcggatcagaagagtcgtcgcatcatgctgcga
gggcatgtggacacagacaacctggaaactgacgaagtggatgaagaaattgttgaattt
ttagtcaaggaagaagtcactctgctggagtag

DBGET integrated database retrieval system