KEGG   Drosophila sechellia: Dsec_GM22281Help
Entry
Dsec_GM22281      CDS       T01064                                 

Definition
GM22281 gene product from transcript GM22281-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dse  Drosophila sechellia
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsec_GM22281
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dsec_GM22281
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dsec_GM22281
  Exosomal proteins of breast milk
   Dsec_GM22281
Heparan sulfate/heparin binding proteins [BR:dse00536]
 Enzymes (General comment) Variety
  Dsec_GM22281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 376 aa AA seqDB search
MRILCVIVILLRLGALGDIAADEEGRSTRSWWDVVPRLLTDIATIKANILTAAPLEWASN
IIDAVCSSTLFMDRIPAQITPDIKKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVV
ILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGV
GLTHLIELTPLRNIHLIGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKIL
PGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGCLTIGCSHTRAVEYFAE
SAYPHQEKNFMGKKCVSWDELRKRDCSPSIVSPMGYRMNPQARGMYYVDVNGWPPYGRNS
ENTIDPRLKTCYLCQR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcggattctgtgtgtcattgttatcctcttacgcctcggagcattgggagatatagct
gctgacgaggagggcaggtcgacgagaagctggtgggatgtagtgcctcgacttttgact
gacatcgctaccattaaggcgaacatactcacagctgctccactcgaatgggcctccaac
ataattgatgctgtgtgttcctccaccctctttatggacagaatacctgcgcaaatcact
ccggacataaagaagatgcattttcagtacatgacgccgtgccagaactacagtgtgccc
ctgctggaggcctcgaagctgtggaagcactctcggttcagcaagggacgtaaggtggta
attctggccaccggatggacaaacactgtaaacgaatcctcggccatttcgatgatctcc
aaggcattcatgtgtcgtggcgatgtgaattttgtgattgtagatgcggctgactatgtg
gacaccttctacgcgtggtcggcgctgaacacggatttaattggcgagcatattggagtt
ggtctgacccaccttatagagctgaccccacttcgaaatatccacttgattggacattca
ctaggagctcacattatgggcactgctggtcggacctttaagaagcttaccggaaaactt
atacccaggataactggcttggatccggccaagccatgtttcaggcgggaaaagattttg
ccaggactgacgcgtggcgatgccaagctagtggacataatccacaccaacattggtatt
ttggccaagcgtggacccctcggggatgtggacttctatcccggcggagcacatcccatc
cagccgggctgcctaaccatcggatgctctcatacccgagccgttgagtatttcgccgag
agtgcatatccacaccaggagaagaacttcatgggcaagaagtgcgtttcttgggatgag
ctaagaaaacgggattgttcacctagcatagtttccccgatgggctatcgaatgaatccc
caagccaggggcatgtactacgtagatgtcaatggctggcccccttacggccgaaactcg
gagaacactattgatcctaggctaaaaacgtgctatctgtgccagaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system