KEGG   Drosophila sechellia: Dsec_GM22284Help
Entry
Dsec_GM22284      CDS       T01064                                 

Definition
GM22284 gene product from transcript GM22284-RA
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsec_GM22284
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dsec_GM22284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 920 aa AA seqDB search
MANYQAVHAQERRIQELDKTVESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAF
RDETDAQRTYREVIFLRAFRCHPNIVRLLDIFKASNNLDFYLVFEFMESDLHNVIKRGNV
LKDVHKRFVMYQLINAIKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIY
DDLEQDGMLTDYVATRWYRAPEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVN
QIEKIVTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALL
VLNPHNRLTAKTAIRHPYVSRFQYASAEMDFHMDIVPPLKDHMRYDVDQYRNSLYELIDR
ETSGSARTVSNSTSSSNRDELAKPVRVTKQTRTISAKQSTTSPAERKKEPSSVEVTQSRR
NIKLLGSAHKAKSTEINRTESAVTQAYIASTPAAAAPPAAASAATAPGAGRKSGEKSVHK
CRHNNAAIQRELAAVAAAAAVVRRKKSTWQSQAKSQGKFHSEAKAHAQTTIQTHKDNMKD
SPPRMMQKSQSPMDAKEPIPQHRYSNKLSQEKKSKEKHHSMLCITRNTFPSDAKHRQQME
ILQREERRQMKRELELKDNQRRRIEAENDPLKETTEQESTTIKEIKRKVCEHTEKKADES
LSKGQHNDSTTFGTCVRERIHHLELEMEKCTEELVDFVELNADVLNYANVSSHLKKLQRS
KENNEKDEDDRRLLPEGICGPGSQNYKIFRQEQEKERQRQVQEFLARDETNEYDNLDLDH
AYRAKYYTAYKEIGKELNPAPDSGGRDSGSEHSPGRDNDCKYADYFRKSTPPKQIWKDLE
RGNELNRGHDRIYELFWLEERREEEKYRRMLAQNDQEELPVHSCGSCRHRHHKHNHNARF
DNLRPTEDDIQEADSSPESN
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggccaactatcaagctgtccacgctcaagagcgacgcatccaagagctggacaaaact
gtggaaagcatcttcgatgtgcgaaagcgcatgggtaagggtgcctatggcatcgtctgg
aaggccaccgacaggcgtacaaagaacacggtggccctgaagaaggtcttcgatgccttc
cgcgacgaaaccgatgcccagcgcacctaccgtgaggtgatattcttgcgggcctttcgc
tgccatcccaacatcgtccggctgttagatatcttcaaggcctccaacaacttggacttt
tatttggtgttcgagttcatggagagcgatctgcacaacgtgatcaagcggggcaatgtc
ctgaaggacgttcacaaacgattcgttatgtaccagctaatcaatgcgattaagtttatt
cactcgggcaacgtcatccacagggacctcaagcccagcaacatcctgatcgatagtaaa
tgcaggctcaaagtggctgacttcggcctggccagaaccctctcctcgagacgcatctat
gatgatttggaacaggacggcatgctgactgattatgttgccacgcgttggtatcgcgcc
cccgaaattctggtggccagtcggaactacaccaagggcatcgatatgtggggcctgggc
tgcatcctgggcgagatgatcaggcagaagcccctattccaaggcactagcactgtcaat
cagattgagaagatcgtgacttccctgccgaatgtgacaaagctggacatcgcttcgatt
ggacccagcttcggcagcgtcctgctgagcaggaatatccaacgcgatcgccgctattcg
ctggacgaaatgatgaagaactgctgcgacgacggtatttcgctggtgaaggccctgctg
gtgctgaatccgcataatcggctgacagccaagacggccataaggcatccttatgtaagt
cgcttccaatacgcgtcggcagagatggatttccacatggacatcgtgccgccgctgaaa
gatcatatgcgctatgacgtagaccagtaccgcaacagtctgtacgaactgattgaccgg
gagaccagtggcagtgcccgcacggtcagcaattccacgtcatccagcaatcgagacgag
ttagcgaaacccgtgcgagtcacgaagcaaaccaggacaatcagtgccaaacaatcgacc
acgagcccggcggaaaggaagaaggagccatcttccgtcgaggtgacccagtcgcgcagg
aacattaagctgctgggctccgcacataaggcgaagtcgacggagatcaatcgcacggag
tctgcagttacgcaagcctatattgcttctactcctgcagcagctgctcctcctgctgct
gcttctgctgctactgctcctggtgcagggcgaaaatctggtgaaaaatctgtgcacaaa
tgccgacacaacaatgcggcgatccaacgggaattggccgccgtggcggccgcggcagcc
gtggttcgccggaagaaaagcacatggcaatcgcaggcaaagtctcaaggcaaattccac
agcgaagcgaaggcccatgctcagactacgattcagacccataaggacaacatgaaagat
agccccccgaggatgatgcaaaagtcccagagcccaatggatgctaaggagccaattcca
cagcatcggtactcaaacaagctgagccaagagaagaaatccaaagagaaacaccacagc
atgctttgcatcacaagaaatacgtttccctcagatgcgaagcatcgccaacagatggag
attcttcagagggaggaaaggaggcaaatgaaacgggagctcgagctaaaggacaaccag
cgccgccgcattgaggcggagaacgatcccttgaaggagacaactgaacaggagtccacg
acgatcaaggagataaaacgaaaggtgtgtgagcatactgagaagaaggcggatgaatcg
ttgtccaagggtcagcataatgattcgaccacctttggcacatgcgtccgcgaacggatc
catcacctggagctagagatggagaagtgcacggaggagttggtggactttgtcgagttg
aatgcggatgtgcttaactatgcgaacgtaagttcgcacttgaaaaagctgcagcggtca
aaggagaataatgagaaggatgaggatgacagaagacttctgccggagggcatttgtggt
cccggctcccaaaactacaagatctttcgccaggagcaagaaaaggagcgccagcgccag
gtgcaggagttcttggcccgcgacgagaccaatgagtacgataatctcgatctggaccac
gcctacagagctaagtactatacagcatataaggaaatagggaaagaactcaaccccgca
ccggacagtgggggacgcgattccggatcggagcactccccggggcgggacaacgactgc
aagtatgccgactactttcgcaaatccacccccccgaagcagatttggaaagatctggag
cgagggaatgaacttaatcgggggcacgaccgcatatacgagttgttttggttggaggag
cgcagggaggaggaaaaatatcgccggatgttggcccagaatgaccaagaagaactccca
gttcacagctgcgggtcgtgccgccatcgccaccacaaacacaaccacaatgctcgcttt
gataacttgaggcccacggaggacgacattcaggaggcggactcatcgccggagagcaac
tga

DBGET integrated database retrieval system