KEGG   Drosophila sechellia: Dsec_GM22343Help
Entry
Dsec_GM22343      CDS       T01064                                 

Definition
GM22343 gene product from transcript GM22343-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dse  Drosophila sechellia
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dse00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 550 aa AA seqDB search
MCGIFAIFSRDGEPIPAQILHGSKHSLRELAYRQSGKQRHRGPDSTGVYVIPSEGVAMVH
ERLRIVGVEMGDQPFVSEDEIYNYLELSAEIAKKRGSYNPKSDCHVILELYQDYGKDLLQ
YITGMFAFALYDRTTKEVLLARDPFGIIPMYVGEDASGNLWVASEMKCLVDTCSKVETFT
PGEARFGKVGDLKTCWQFQESWIKEVPTQTCDLSLLRANLESAVRSHLQCDVHLGALLSG
GVDSSLIASIATKIMRERDPNFRLKTFSVGLKDAPDFQAARSVAKYIDSDHKEIIFEIEE
ALDGIRDIVYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIFGGYLYFHKA
PSYDDFHEELVKRVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQIRPEDKIPG
PLNKFGEVQQKRLEKYVLRAAFADNYLPDEVLWRQKEQFSDGVGYDWIDSIRRVATSHVS
DEEFSAAALRFPFNTPTTKEAFYYRCIFAEQFPGESAARTVVRWVPRLDWGCPEDPSGRA
QAVHQVNKDC
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttttgccatattttcgagggatggggagccgatacccgcacaaatcctc
catggcagcaagcacagtttaagggaactggcctatcgacagagtggcaagcagcggcat
cgtggtccggattccacgggcgtctatgtgattccctcggaaggagtggccatggttcat
gaacgcctgcgaatcgttggcgtggaaatgggcgaccagcccttcgtctctgaggatgag
atctacaactatctggagctttcggctgagattgcgaaaaagcgtggctcctacaacccc
aagagcgattgccacgtgatactggaattgtaccaggattatggaaaggaccttctgcaa
tacatcaccggaatgtttgctttcgccttgtacgataggacgaccaaggaagtgcttctt
gcccgagacccctttggcattatacccatgtatgtgggtgaggatgcgtcgggaaacctt
tgggtggcctcggagatgaagtgcctggtggatacctgctccaaagtggagactttcaca
cctggcgaggctcgcttcggtaaagttggtgaccttaaaacatgctggcagttccaggag
tcttggatcaaggaggtgcccacgcaaacctgcgacttgtcgctactgcgagccaacttg
gagtctgccgtgcgcagtcatctgcagtgcgatgttcacctgggagccctgctgtccggc
ggagtggattccagtcttatagcctctatagccacgaagataatgcgcgaacgggatccc
aacttccgtctgaaaacattctctgtgggtctaaaggatgcacccgacttccaggcggcc
aggagtgtggccaaatatatagacagcgatcacaaggagatcatattcgagatcgaagaa
gctctggatggcattagggatattgtctaccacctggaaacctatgatgtgaccaccgtg
agatgtagtttgccgatgctgttactggctagatatatcaagagcaccggcatcaagatg
atcctctccggcgaaggagccgatgagatctttggagggtatttatacttccacaaggcc
ccaagctacgacgatttccacgaggagttggtgaagagagtgcgccaactgcatttatcc
gattgtttgcgggccaacaaggtggccatggccaagggcgtggagctgcgagtgcccttt
ctggacacgggattcgttaaccatgtaatgcaaatccggccggaggataagatacccggg
ccccttaacaaattcggggaagtacagcaaaaacgattggagaagtatgtccttcgagct
gcctttgcggataactatctgcccgatgaagtcctctggcgccagaaggagcagttctcc
gacggagtgggctacgattggatcgacagcatccgccgggtggccaccagccatgtcagc
gatgaagaattctccgcagccgccctacgctttccctttaacacgcccaccaccaaggag
gccttctactatcgctgcattttcgccgaacaattccccggagaatcggcagcccgaacc
gtggtcagatgggtgccacgcctcgattggggctgtccggaggatccatccggacgggcg
caggccgtccaccaggtcaacaaagactgctag

DBGET integrated database retrieval system