KEGG   Drosophila sechellia: Dsec_GM22410Help
Entry
Dsec_GM22410      CDS       T01064                                 

Definition
GM22410 gene product from transcript GM22410-RA
Orthology
K06634  
cyclin H
Organism
dse  Drosophila sechellia
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dse03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dse03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MYTVSSQKRSWTFANEGQLMDFRVEQNSKYIELHEEEAQGRDLNEHFLTSAEERLLLKQY
EIYLFDFCRRFEPPMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNP
DRLRPHIDSFLDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPAEDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtataccgtgagctcgcagaaaaggtcctggacattcgccaatgagggccagctcatg
gatttccgcgtggagcagaacagcaagtacatcgagttgcacgaggaggaggcgcagggt
cgcgacctcaatgagcactttctcacgtcggcggaggagcgcctgttgctgaagcagtac
gagatctacctgttcgacttctgccgccgcttcgaaccgccgatgcccaagtgcgtggtg
ggcacggccttccactacttcaagcggttctatctgaacaactcccccatggactatcac
cccaaggagattctagccacatgtgtgttcgttgcctgcaaagtggaggagttcaacgtg
tccatcaaccagttcgtgaacaacatcaagggcgacaggaacaaggccacagacatagtg
ttgtccaatgaattactgctgattggacagctcaactactacctcaccatacacaatccg
ttcagacccatcgagggcttcctgatagatataaaaactcgcagcaatatgcagaatcca
gatcgtctgcggccacacattgatagttttctcgattccacatactactcggatgcctgt
cttctgcatacgccttcgcaaattgcattggctgccgtcctccacgcggccagcagagag
caagagaatctcgatagttatgtgacggatcttctctttgtctccgccagagagaagcta
cccggactcatagatgccgtgcgaaaaattcgcataatggtgaagcaatatcagcagccc
gatcgggaaaaggtcaaggccatcgagaagaagttggacaagtgccgaaatcaagccaat
aaccctgatagcgaactctataaggagcgcctacgccgattgtacaccgatgaggatgac
atgcccgccgaagatgcctcattccacattgcagatgtgagctcggacacatctgctatg
aacatcagccaatag

DBGET integrated database retrieval system