KEGG   Drosophila sechellia: Dsec_GM22423Help
Entry
Dsec_GM22423      CDS       T01064                                 

Definition
GM22423 gene product from transcript GM22423-RA
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dse  Drosophila sechellia
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dse01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dse00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 776 aa AA seqDB search
MLQNSFKLAQSLRNGFSRNAWRAFSSHGPRQPLVSPERRLEKAHPTFTERSQLKYARRLV
VKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMS
LSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYN
EETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAML
AAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTYTSDDSNSIEFGKKSKVGTGGMDSKVK
AATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESANAVPVEVMAENARTGSR
QMQALTPAQRASAVNTLADLLVSREKFILDANAKDLAEAQKSGLAKPLLSRLSLNPAKLK
NLSVGLKQIAEDSHKNVGRVLRRTRLADQLELKQVTVPIGVLLVIFESRPDSLPQVAALA
MASANGLLLKGGKEAAHSNKALMELVKEALATVGAEHAVSLVSTREEISDLLSMENHIDL
IIPRGSSDLVRSIQQQSLHIPVLGHAEGVCHVYIDRDADLEKALRIARDAKCDYPAACNA
METLLIHEDLMSGAIFGDVCNMLKREGVKIYAGPRLNQQLTFGPPAAKSLKHEYGALECC
IEVVPSLDEAINHIHTYGSSHTDVIVTENDAAAKQFLGSVDSACVFHNASSRFADGFRFG
LGAEVGISTARIHARGPVGVEGLLTTKWILEGQDHAAADFAEGGGRTWLHETLPLD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaaacagtttcaagctggcccagagcctccgaaacggattctccagaaacgcc
tggcgagcgttcagctcccacggaccccggcagccactggtgtcgccggagcggcgcttg
gaaaaggcgcatcccaccttcacggaaaggagtcagttgaagtacgcccggaggctggtg
gtcaagttgggcagtgcagtcattactcgagaggacaaccatggactagcactcggccga
ctggcgtctattgtggagcaggttgccgagtgccatttggagggacgtgaagtgatgatg
gtcaccagcggagcggtggccttcggaaagcagaagctcgcccaggagctcctcatgtcg
ctttccatgcgcgagaccctgaacccaaaagatagcaaagagttcgacggcgccacgctg
gaaccgcgagcggcggctgcggtgggtcagtcgggtctgatgtccctctacgacgcgatg
tttgcccagtacggagtcaagatagcccaggtgctcgtgaccaagccggacttctacaac
gaggagacacgcaacaatctcttctgcacgctctccgaattaattagcctgaatattgtg
ccaatcataaatactaacgacgccgtctccccgccgatgttcatacgtgacgacgagcca
gccggcggagccaggaggggtattcccattaaggacaacgacagcttgtctgccatgctg
gccgccgaggtgcaggctgatctgctaatcctgatgtcggacgtcgatggtatctacaat
aagccgccgtgggaggacggggcgaagctgatgcacacctacaccagcgacgacagcaac
agcatcgagtttggcaaaaagtcaaaggtgggtactggcggcatggactccaaggtgaag
gcggccacctgggccctggaccggggcgtcagcgtggtcatctgcaacggaatgcaggag
aaggccatcaagaccataattggcggccggaaggtgggcaccttcttcacggaggccacc
gagagcgccaatgcagtgcccgtcgaggtgatggccgagaacgcacgaaccgggagtcgc
cagatgcaagctctcacgcccgctcagagggccagtgctgtcaacaccctggccgatctg
ctggtgagccgcgaaaagtttatcctggacgccaatgccaaggacctggccgaggcgcaa
aagagcggactggccaagccgttgttgtcgcggctttcgctcaacccggccaagctaaag
aacctctccgttggcctgaagcaaatcgccgaggacagtcacaagaatgttggccgtgta
ctgagacgcacccgccttgcggatcagctggagctcaagcaggtcaccgtgcccataggc
gtcctgctggtcatcttcgaatcccgtccagactcgctgcctcaggtggccgccttggca
atggcctcggccaacggactgctcctcaagggcggcaaggaggcggcacacagcaacaag
gctctcatggagctggtcaaggaggcgctggccaccgtgggagcggagcacgctgtctca
ctggtttccacgcgcgaggagatcagtgatctgctgtccatggagaaccacatcgacctg
atcatcccgcgcggctcctccgacttggtgcgcagcatccagcagcagtcgctgcacatc
cccgtgctgggccacgccgaaggcgtctgccacgtctatattgacagggatgcggatttg
gagaaggccctgcgcattgcacgcgacgccaagtgcgactatccggctgcctgcaacgcc
atggagaccctgctgatccatgaggacctgatgagtggcgcaatcttcggcgatgtctgc
aacatgctgaaacgtgagggcgtcaaaatctatgccggaccccggctgaaccagcagctg
acctttggcccgccggcggccaagagcctgaagcacgagtacggcgccctcgagtgctgc
atcgaggtggtgcccagcctggacgaggccattaatcacatccatacgtacggcagcagc
cacacggatgtcattgttacggaaaatgatgcggcggccaagcagttcctgggcagcgtg
gacagcgcctgtgtgttccacaacgccagctcccggttcgcggacggcttccggttcggc
cttggcgccgaggtgggcatctccaccgccaggatccacgcccgcgggccagtgggcgtg
gaggggctgctgaccaccaagtggatcctcgaggggcaggaccacgccgccgccgacttt
gccgagggaggtggccgcacgtggctgcacgagaccctgccgttggactaa

DBGET integrated database retrieval system