KEGG   Drosophila sechellia: Dsec_GM22522Help
Entry
Dsec_GM22522      CDS       T01064                                 

Definition
GM22522 gene product from transcript GM22522-RA
Orthology
K04646  
clathrin heavy chain
Organism
dse  Drosophila sechellia
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dse04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dse04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1678 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIDANKEPTTLFCFAVRTATGGKLHIIEVGAPPSGN
QPFAKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYVFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTNKALIDLFEGFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQY
YDSRVVGRYCEKRDPHLACVAYERGLCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSESNPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLENYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGNRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDQLYKDAMEYAAESCKQDIAEELLGWFLE
RDAYDCFAACLYQCYDLLRPDVILELAWKHKIVDFAMPYLIQVLREYTTKVDKLELNEAQ
REKEDDSTEHKNIIQMEPQLMITAGPAMGIPPQYAQNYPPGAATVTAAGGRNMGYPYL
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccactgcccatccgctttcaggagcatttacagctcacaaatgtcgggatc
aacgccaattcattttcattcagcacgctcacgatggaatcggataagtttatttgcgtg
cgggagaaggtgaatgataccgcccaagtggtcatcattgacatgaacgatgccaccaat
cccacgcggcgtcccatctcagcggattcggctatcatgaatccagctagcaaggtcatt
gcgctcaaagcgcaaaagacgttgcagatcttcaacattgagatgaagtccaagatgaag
gcgcataccatgaacgaggatgtggtgttctggaagtggatctccctcaatacgctagct
ctggtcacagaaacgagtgtgttccattggtccatggagggcgattcgatgccgcaaaag
atgtttgaccggcattcatcgctgaacgggtgtcaaatcatcaactaccgctgcaatgcc
tcccagcagtggctactcctggtcggcatttcggcactgccaagtcgcgttgccggtgcc
atgcagttgtattcggtggagcgcaaggtctcccaggcgatcgaggggcatgcggccagc
tttgccacgttcaaaatcgatgccaacaaggagccgaccacgctgttctgctttgcagtg
cgtacggccactgggggcaagcttcatattatcgaagttggtgctccgccgagcggcaat
cagccgtttgccaagaaggctgtcgatgtcttctttccgccggaagcacaaaatgatttc
cctgtggcaatgcaagtctctgccaagtacgacaccatctacttgataaccaagtatgga
tacatacatctgtatgacatggagacggccacgtgcatatacatgaatcgtatatcggcc
gatacgatctttgttaccgcaccgcatgaggcaagtggcggcatcattggcgtcaatcgc
aagggacaagtcctctccgtgaccgtcgacgaggagcagatcattccctacatcaacacc
gttttgcagaatcccgacttggcccttcgcatggccgtgcgcaacaatttggctggtgcc
gaagatctctttgtgcgaaagttcaacaagctctttaccgccggccagtatgccgaggcg
gctaaagttgctgccctggcgcccaaggccattctgcgtacgccacagacgatccagcgt
ttccaacaggtgcagacaccagctggctccacgactccgccgctgctgcaatactttggc
attctcctcgaccagggcaagctgaacaagttcgagtctctggagctgtgccgtcccgtc
ttgctgcagggcaagaagcagctgtgcgagaagtggctgaaggaggagaagctggagtgc
agcgaggagttgggtgatctggtcaaggcctccgatcttacacttgccctgtccatctat
ctacgcgcaaatgtgcccaacaaggtgatccaatgctttgctgagactgggcagttccag
aagattgtactctacgccaagaaggtcaactatacgcccgattacgtgttccttctgcgc
tccgtgatgcgaagcaacccagagcagggagctggtttcgcctctatgttggtggccgaa
gaagagccactggcggacatcaatcagattgtggacatcttcatggagcattccatggtg
cagcagtgcactgcgtttctgctggacgccctcaagcataaccgacccgccgagggtgcc
ctccagacgcgcctgctggaaatgaatctgatgtctgctccgcaggtggccgacgccatc
ctgggcaacgctatgttcacccactacgatcgggcccacattgcccagctgtgcgagaag
gctggactgctccagcgcgccctcgagcactacacggatctgtatgacattaagcgggcc
gttgtgcacacgcacatgctgaatgccgaatggctggtcagtttctttggcacgctgtcg
gtggaggactcgctggaatgtctgaaggcaatgcttacggcgaatttgcgccagaacttg
cagatctgtgtgcagattgccaccaagtaccacgaacagctgactaacaaggcactgatt
gacctgttcgaaggtttcaagagctacgacggactgttctacttcctgagcagcattgtc
aacttctcacaggatcccgaagtgcacttcaaatacattcaggcggcctgcaagactaat
cagatcaaggaggtggagcgtatttgccgcgaatcaaactgctacaatcccgaacgggtg
aagaacttcttgaaggaggccaagctgacggatcagctaccattaattattgtttgtgat
cgttttgatttcgtgcacgacttggtgctttacctgtatcgtaacaatctgcagaagtac
atcgagatctatgtgcagaaagtgaatccatcccgcttgccagttgtagtgggtgggctt
cttgatgttgattgcagtgaggacataattaaaaatctaattctcgttgtcaagggacaa
ttctcaaccgacgaactggtcgaggaggtcgagaagcgcaaccgtctcaagctcctcctt
ccctggctggagtcccgagttcacgagggctgcgtcgagccagccacccacaatgccttg
gccaagatctacattgactcgaacaacaatcccgagagatttcttaaggagaatcagtac
tacgatagccgtgtggtcggtcgctactgcgagaagcgggatccccatttggcgtgtgtg
gcctacgagcgtggattgtgcgaccgcgagctgatcgccgtttgtaacgagaattcactg
tttaagagcgaagcacgctacttggttggtcgtcgcgacgccgaactctgggccgaggtc
ctttcggagagcaatccctacaagcgtcagttgatcgatcaggtggtacagaccgctttg
tccgagacccaggatcccgatgacatctcggtgacggtcaaggcattcatgaccgccgat
ttgcccaatgagctgatcgaacttctcgagaagattattctcgactcgtccgtttttagc
gaccatcgcaatctgcagaacttgcttattctcacagccattaaggctgatcgcacacga
gtcatggactacatcaaccggctggagaactacgatgcaccggacattgcgaacattgcg
attagtaatcagttgtacgaagaagccttcgccatcttcaagaagttcgatgtgaacaca
tcggccattcaggtgctcatcgatcaagtgaacaacctggagcgggctaacgagttcgcc
gagcggtgcaatgagccggccgtttggtcgcagctggccaaggcccaactgcagcagggt
ctggtcaaggaggctatcgattcgtacatcaaggctgatgatccgagcgcctacgtcgat
gtcgtcgatgtggccagcaaggtggagtcttgggatgacctcgttcgctatctgcaaatg
gcacgcaagaaggcacgcgaatcttacatcgagagcgaattgatctatgcctatgcgcgc
actggacgtctggccgatctggaggagttcatttcgggtcccaaccatgccgatatccag
aagattggcaaccgttgcttcagcgacggcatgtacgatgcagcgaagctactgtacaac
aatgtgagcaactttgcccgtctggccatcactttggtctacctgaaggagttccaaggg
gccgtggactcggcgcggaaagccaactcaacgcgcacatggaaggaggtgtgcttcgcc
tgcgtggacgccgaggagtttaggctagcccagatgtgtggcctgcacattgtggtgcat
gccgatgagctggaggatctgattaactactatcagaaccggggatacttcgatgaattg
attgcgctgctcgagtcggctttggggctggaacgtgcgcacatgggaatgttcaccgaa
ttagctatactttattcaaaattcaaaccttccaaaatgcgcgaacacttggagctgttc
tggtctcgcgttaacattccaaaagttctgcgtgccgctgaatcggctcatttgtggtcg
gagctggtgttcctgtacgataagtacgaggagtacgacaacgccgtcctggccatgatg
gctcatcccacggaggcgtggcgcgaggggcacttcaaggacatcatcaccaaggtggcc
aacattgagctgtactacaaggccatcgaattctatttggacttcaagccgctgctgttg
aacgacatgctgctcgtgctggcacccaggatggatcacactcgtgctgttagttacttc
tccaaaaccggctatttgccactcgtcaagccttatctgcgttcagtccaatctctcaat
aacaaggcaatcaacgaagccctgaacggactcttaatcgacgaggaggactaccagggc
ctgcgcaattcgatcgatggatttgacaactttgacaacattgcgttggcacagaaactc
gaaaagcacgaacttaccgaattccgtaggattgccgcctacttgtacaagggaaataac
cgctggaaacagagcgttgagctctgcaaaaaggaccaactctacaaggatgctatggag
tacgccgccgaatcttgcaagcaagatattgccgaggagttgttgggttggttcctagaa
cgtgacgcttacgattgttttgcagcttgtctttatcagtgttacgacttgctgcgccct
gatgttatcttggagttggcctggaaacacaaaatcgttgacttcgccatgccctatttg
attcaggttctgcgtgaatacacaacaaaggtggacaaacttgagttgaacgaggctcag
cgcgagaaggaggacgattccactgagcacaaaaacattattcagatggagccgcaactg
atgatcaccgctggcccagcaatgggcattcctccacaatatgcacagaattatccaccc
ggtgcagcaacggtaacggcggcaggcggacgcaacatgggctatccctacttgtag

DBGET integrated database retrieval system