KEGG   Drosophila sechellia: Dsec_GM22846Help
Entry
Dsec_GM22846      CDS       T01064                                 

Definition
GM22846 gene product from transcript GM22846-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 607 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSGGSVDGAQGSGSGGGRQRHAPLYGRFVDAEDLPA
THRDVMHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLSVDLIKTYKHINEVYYAKKK
RRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVK
AYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLC
LVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILL
CNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMH
TGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKNQNGRKY
KPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQ
HNFFKRTADEATNTSGAGATANAGAGGSGSSGAGGSSGGGVGGGLGTSNSSSGAVSSSSA
AAPTAATAAATAAGSSGSVSSVGGGSSAAQQQQAMPLPLPLPLPLPPLAGPGGASDGQCH
VRRIVRI
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattagaggatacgaatagcggcggcgttatggataagaataaacagaaactg
tctgcttatgggtccagcgggggcagcgtcgacggagcgcagggcagcggaagcgggggc
ggaagacagcgccacgcccccctctacgggcgattcgtcgacgcagaggatctgcctgcc
acgcaccgggatgtcatgcaccatcactctagtccttcgtcttcgtcggaggtgcgcgcc
atgcaggcccggattcccaaccactttcgggagcccgcctcgggacctttgcgcaagctg
agtgtcgatctgataaagacctacaagcacatcaacgaggtttactatgcgaaaaagaaa
cgtcgtgcccagcagacgcaaggagacgacgactcatctaacaaaaaggagcgaaaactt
tataacgacggctacgacgacgataatcacgactatataatcaagaatggcgaaaagttt
ttggatcgctacgagatcgactctctgatcggcaaaggcagttttggccaggtggtgaag
gcttacgaccacgaggagcagtgccacgtggcgatcaagataattaagaataagaaaccg
ttcctaaaccaggcacagatcgaggtcaagttgctcgagatgatgaaccgggcggatgcc
gaaaacaaatactacatcgttaagctcaagcggcacttcatgtggcgcaaccacctgtgc
ctggtgttcgagctgctctcatacaacctgtacgacctgctgcggaacaccaacttccgg
ggcgtttcgctgaacctcacgcgcaagttcgcccagcagctgtgcaccgcactgctcttc
ctcagcacccccgaactgaacataattcactgtgatttgaagcccgagaacatcctgctg
tgcaacccgaagcgctcggcgatcaagatcgttgactttggcagctcctgccagttggga
cagcggatctaccactacatccagtcgcgcttctaccgctcgccggaggtgctgcttggc
atccagtatgacctggccatcgacatgtggtcactgggctgcatcttggtcgagatgcac
accggcgagccgctcttctccggctgcaacgaggtggaccagatgaacaagatcgtcgag
gtgctgggcatgccgcccaagtatctgctcgaccaggcgcacaagacccgcaagttcttc
gacaagatcgtcgccgatggctcctatgttctgaagaagaatcagaacggcaggaagtac
aagccaccaggatcccgcaagcttcacgacatcctcggagtggaaacaggcggtccaggg
ggcaggcgtctcgatgagccgggccactccgtctcggactatctgaagttcaaggatctg
atcctgcgcatgctcgactttgaccctaagacacgggtcacgccctactatgccctgcag
cacaacttcttcaagcgcacggcagacgaggcaaccaacacgagcggcgcgggcgccaca
gcgaacgcaggagccggtggctccggttccagcggagcaggaggctccagcggcggaggc
gtcggcggcggcctcggaacgagcaacagcagtagcggtgcggtctcctcatccagtgca
gcggctccaacggcggcgacagcagcggccacggccgcaggatcctccggttcggtttca
agtgtcggcgggggatcctccgcagcgcagcaacagcaggcgatgccgctgccattgccg
cttcccttgccgttgccaccactcgcgggtcctggcggtgcgtcagatggccaatgtcac
gttcggcgcatagtgcgaatttaa

DBGET integrated database retrieval system