KEGG   Drosophila sechellia: Dsec_GM22990Help
Entry
Dsec_GM22990      CDS       T01064                                 

Definition
GM22990 gene product from transcript GM22990-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dse  Drosophila sechellia
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM22990
   03008 Ribosome biogenesis in eukaryotes
    Dsec_GM22990
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dsec_GM22990
Ribosome biogenesis [BR:dse03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dsec_GM22990
Transfer RNA biogenesis [BR:dse03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dsec_GM22990
Mitochondrial biogenesis [BR:dse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dsec_GM22990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 166 aa AA seqDB search
MGSNHPEHGTKPRSTKHHKQQNHRVVRKQPPRPAVSDRHNIYITSKTDLKAQQRRCEELI
NSGVHEIFLHCMGFSVTRGLNIALRLVQNSEGALSYAINTSTVQLVDELHPLCDAEDITF
RQRNNSALHIKISNNSLFDIVVPQPSQSQTQAQSLGQFRGKAKARQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcaatcatcccgagcacgggaccaagccgagatccaccaaacaccacaagcaa
cagaaccaccgagtggtgcgcaagcagccgccgcgccccgcagtcagcgaccgccacaac
atctacatcaccagcaagacagacttgaaggcccagcagcgccgctgcgaggagctgatc
aactccggggtccacgagatctttctgcattgcatgggcttctccgtcacccgcggcctc
aatatcgccctgcgcctcgtccagaattctgaaggcgccctcagctacgccatcaacacc
tccaccgttcaactggtggacgaactgcaccctctgtgcgatgccgaggacataaccttc
cgccagcgcaacaactcggccctgcacatcaagatctccaataacagtctcttcgacatc
gtcgtgccgcaaccgtcgcagtcccagacgcaagcccagtccctgggccagttccgaggc
aaggcgaaggccaggcagtag

DBGET integrated database retrieval system