KEGG   Drosophila sechellia: Dsec_GM22997Help
Entry
Dsec_GM22997      CDS       T01064                                 

Definition
GM22997 gene product from transcript GM22997-RA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dse  Drosophila sechellia
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM22997
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dsec_GM22997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1638 aa AA seqDB search
LDTNFELLMLCVAKMHGDPRVTIRLCDEYWGPGEPTNCTAYKNTSRSVSLFKFVSLASEL
LPQTLFKSYLKMISGLTRTDFSARCAFNMLRVHQIATGGQYAVSWDHFFTTLGNYYNSMR
NDFHTNIGMSGETFYRTRSTPKAITQREAEHLMAVMGIIQAVAEHDEVSRIMICEHPNWQ
TPQVLLGLVACATPLLLKAEILQTLAALAKSKETARVIWFHLEASQIIPTAPVPRSYGGQ
CSLLQEMEQIESRSEQYDLSRGILQLLYTLMTTNLPKSFSGGQRTPAYEGYLKSMINSVL
LKFYNRSYKVPSEKWQVGALCLKLLYYLLATYRPCAMDFLEKPDEPPYPGFHVMLQLQLK
SEMLQLLLSIVEDVRERLDDYNRFQGKELLEECSLYALLILEAALAKQNAFFEAHSTANC
PILLMGLNRMLLDLNPRSRNPDHVLNIIKYVTYNSWLPRHALAAIKILASVTQLPNVSTQ
ILSMYGQGSNEKLEIRQGFVECLEMEVCAGRHDDELLDQLALNNHVPYLGFSDELDNEGE
VSGERECTTLESPLELQAGEGALESKPASIELQLKEAIIKLFEMNLSQQLPNFVYFLLGV
DVLREFMANGRQHLGIEMQSSCVNSVVLLLEKYLDKQRHGDKYCEHTARIVERIYHLFHG
LCANRRTTETILRYFRLTCSDFLMRHLRSLPFRQHREDHVLHAMGHLLNCVSIDVKLAAK
HGQMTRFNQLCDILLMGNAMERSSHGMSMELGHSLITQTSSSFLAMDALPPGGSISGVGS
GAGSAPLGAPSTGVKSLQPSLLQETSQGLHVIRMLDILVLEAGALIQPQLEFFDSHLVTQ
LLRECEASAEAGANSRANLINVRKLYYTLTDELNMVQSIIASGQRKAISTEIMLLLNHAV
NINRVRTQRCATLAFMSAWGQLVQVLFSNMPEGVLPATQRREHIIDIVEKVLIKVQPIQP
IIEISVKVSETVLLLLANLRFCCYQAEDQSPEDLAAEESLTNGNGIGIGNDSQVSKLGLG
QRPIGQCADGGSGGGRDIGSGGNSSNLRFIVKNIVQWIMISEVKSQQLRINLYSALLNCL
RIGKRLRTDEQLEYQETLISRQESARTNSTEQRRGDRLRLKAMAAEVIGAFGEKLIDTIC
HDAVTGHDVCRMLALACLDMISELQAVSTLCDFVASRGYLKHILESLDQSSPALCAVLQP
VPENLRPLYVYESRMAFLTRMANSNVGARLLLAEQALGVLSNMKVYDLQPDVKSSELNRN
EPQNFLPSIDERFRSILLPALSLCDAIINSLGPLNNSAALQVLNFLFAHIDMVEAMLRSA
TPYMDLGHLEQVAVISSLFARASKHDLTVLEDSVKLQLRNRLGRVQQLMIVVFGRFCVSE
PTIRRMLQQDQDQQTNPTEDAKRLRVKYFLDIAANVSLYCRNVVTSHSKKSMTSKYLLTT
VINDVTLLTGKIASKKLTAILHTILNQLKGSIGHYLSQKSIADNLLQQRASLPNISFGPN
GKQSYIELSQRYNEKHSELRQSVFIAEQNLYLLWIHLDFYMRNTIDYANENRNTINESNM
DDDGNDVSVLNASQDEILQLKQLLISTFNETFCTQLITASEEYSIKCKGFNASLLRRIKS
LVQFAPITANDVTSSFDS
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
ttggacaccaacttcgagctgctcatgctgtgcgtggccaagatgcacggagatccgcgc
gtcaccatcaggctgtgcgacgagtactggggccccggcgaacccaccaactgcacggca
tacaagaacacctcgcgctcggtgtccctgttcaagttcgttagcttggccagcgagctg
ctgccacagacgctgttcaagtcctacctcaagatgatatccggactcacacgcaccgat
ttctcggcccgctgcgccttcaacatgcttagggtgcaccagatagccaccggcggccag
tatgcggttagctgggatcacttcttcacgaccctgggcaactactacaattcgatgcgc
aacgacttccacaccaacatcggcatgagcggcgagaccttctaccgcacccgatcgacg
ccaaaggccattacgcagcgagaggcggagcacctgatggccgtaatgggcatcatacag
gcggtggcggagcacgacgaggtctcgcgcatcatgatctgcgagcatcccaattggcag
acgccgcaggtgctcctgggcctggtagcgtgcgccacgccgctgctgctcaaggcggag
attctgcagacgctggctgccctggccaaatcgaaggagacggcgcgcgtcatctggttc
cacctggaggcctcgcagatcatacccactgcgcccgtgcctagaagctatggcggccag
tgtagtttgttgcaggagatggaacaaatcgagagccgttcggagcagtacgacctgtcg
cgcggcatcctgcagctgctctacacactgatgaccaccaacctgccgaagagttttagc
ggggggcagcggacaccggcctacgaaggctatctcaagtccatgatcaattcggtgctg
ctcaagttttacaatcgctcgtacaaggtgccctccgagaagtggcaggttggcgccctg
tgcctgaaactgctctactacctactggccacctaccggccgtgcgcaatggactttctg
gagaaacccgacgaacctccctatccgggcttccacgtcatgttgcagctgcagctgaag
tccgaaatgttgcagctgctgctgtccattgtggaggatgtgcgtgagcggctggacgac
tacaaccgcttccagggcaaggagctactcgaggagtgctccctgtacgcactgctgatc
ctggaagccgcgctggcgaagcagaacgctttctttgaggcccactcgacggccaactgc
cccattttgctgatgggcctgaaccgcatgctcctggatctgaatccacgcagccgcaac
cccgatcacgtgctgaacatcatcaagtatgtgacctataatagctggctgccgcgccac
gccctggccgccattaagattctggcttcggtcacccagctgccgaatgtctccacccag
atactcagcatgtacggccagggcagcaatgagaagctcgagatccgtcagggtttcgtc
gagtgcctggaaatggaggtgtgcgcgggcaggcacgacgacgagttgttggaccaactg
gccctcaacaatcacgttccctatctgggcttcagcgatgagctggacaatgagggagag
gtgagcggggaacgcgaatgtacaactttggaatcgccactggagctgcaggcgggggag
ggcgcgctggagagcaaaccggccagcatcgagctgcaactgaaggaggccattatcaag
ctgttcgagatgaatcttagccagcagttgcccaactttgtgtacttcctgctcggcgtg
gacgtgctgcgcgaattcatggccaacgggcggcaacacctgggcatcgagatgcaaagc
tcgtgcgtgaactccgtagtgctgttgctggaaaagtacctggataaacagcgtcacggc
gataagtactgcgagcacacggcgagaatcgtggagcgcatttaccatctgttccatggt
ctatgcgccaatcgccgcaccacggagacgatactgcgctacttccggctgacctgcagc
gacttcctgatgcgtcaccttcgctcgctgccctttcgtcagcatcgcgaggatcacgtg
ctgcacgccatgggccacctgctcaactgcgtctccatcgatgtcaaactggcggccaaa
catggccagatgacgcgcttcaaccagctgtgcgacattttgctaatgggaaacgccatg
gagcgctcatcccatggcatgtcgatggagttgggccacagcctgattacacagacgtcg
tcatcgttcctcgccatggatgccctaccgcccggtggatcgataagtggcgtgggatct
ggggctggttcggcgcctctcggagctccaagtactggggtcaaatccctgcagccatcg
ctgctgcaggagacatcgcagggactgcacgtcatccgaatgctagatatcctcgtcctg
gaggcgggcgcgttgatccagccgcagctggagttcttcgactcgcatctggtcacccaa
ctgctgcgcgagtgcgaggcatccgccgaagctggcgccaattccagggccaacttgatc
aacgtgcgcaaactgtactacactctcacagacgagctgaacatggtgcagagcatcatt
gccagcggccagcggaaggccatctccacggaaatcatgctgctgctcaaccacgccgtc
aacataaatcgcgtgcggacgcagcgctgcgccacgctagccttcatgtcagcgtggggt
caactggtgcaggtgctcttcagcaacatgcccgagggcgtgcttccggcgacgcagcgt
cgcgagcacataatcgacatcgtcgagaaggtcctcatcaaggtgcagcccatacagccc
atcatcgagatttccgtaaaggtgagcgagacggtgctgctgctgcttgccaatctgcgc
ttctgctgctaccaggccgaggaccagagcccagaggatctggccgccgaggagtcgctc
accaatggcaacggcatcggcatcggcaacgattcgcaggtctccaaattgggtctgggc
cagaggccaatcggccagtgtgcggatggcggcagtggaggtggacgggatatcggttcc
ggtggcaacagcagcaatctgcgcttcatcgtcaagaacatcgtccagtggatcatgatc
agcgaggtgaagtcgcagcagctgcgcatcaatctgtacagtgccctgctgaattgcctg
cggattgggaagcgactgcgcaccgacgagcaactggagtaccaggagacgttgatttcg
cgccaggagagcgcacgtaccaacagcacggagcagcggcgcggcgaccgtctgcgtctg
aaggccatggcggcggaagtgattggcgcgttcggcgagaagctgatcgacaccatctgc
cacgacgcggtgaccggccacgatgtgtgccgcatgctggcgctggcctgcttggacatg
atctccgagctgcaggcggtgagcacgctgtgcgactttgtggcgtcgcggggctacctc
aagcacatactggaaagcctggaccagtccagtccggcgctgtgcgcggttctgcagccc
gtgccggaaaacctgaggccgctctacgtctacgagtcgcgcatggccttcctcacgcgc
atggcaaacagcaatgtgggagcccggctcctcctcgccgagcaggcgctgggtgtgctg
tcgaatatgaaggtctacgacctgcagcccgacgtgaagtccagcgagctgaatcgtaac
gagccgcagaacttcctcccgtccatcgatgagcgcttccggtcgatcctcctgccggca
ctgagcctctgcgatgccattatcaactcgctgggcccgctcaacaactccgccgccctg
caggtgctcaacttcctgttcgcccacatcgacatggtcgaggccatgttgcgctcggcc
acgccgtatatggacctcggccacttggagcaggtggcggtcatcagcagtctgtttgcc
cgcgcctccaagcacgatttgaccgtgctggaggacagcgtgaagctgcagctgcgcaat
cgcctgggccgcgtgcagcagctgatgatcgtggtgttcggacgcttctgcgtaagcgag
cccaccattcggcgcatgctgcagcaggatcaggatcagcagaccaaccccactgaggac
gcgaagaggctacgtgtcaagtatttcctggacatagcagccaacgtgtcgctctactgc
cgcaacgtggtcaccagccactcgaagaagagcatgacctccaaatacttgctgaccacc
gtgatcaatgatgtgacgctgctcactggcaaaatagccagcaaaaagctgacggccatc
ctgcacaccatcctcaaccagctgaagggctccatcggccactacctctcgcagaagtcg
atcgccgacaatctcctccagcaacgcgcctccctgcccaacatcagctttgggcccaac
ggtaaacaaagctacatcgaactgagccagcggtacaacgagaagcacagcgaactgagg
cagtccgtcttcatagccgagcagaacctgtatctgctgtggatccatctggacttctat
atgcgcaacaccatcgactacgccaacgaaaacaggaacaccatcaacgagagcaatatg
gacgacgacggcaacgacgtgtccgtgctgaacgcctcgcaggatgagatcctgcagctc
aagcagctcctcatctccacattcaacgagaccttctgcacgcagctaatcaccgccagc
gaggaatactcgatcaagtgcaaaggcttcaacgcctcgctcctccgccgcattaagtcg
ctcgtccagttcgcccccatcactgccaacgacgtcacctccagcttcgattcgtag

DBGET integrated database retrieval system