KEGG   Drosophila sechellia: Dsec_GM23222Help
Entry
Dsec_GM23222      CDS       T01064                                 

Definition
GM23222 gene product from transcript GM23222-RA
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dse  Drosophila sechellia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsec_GM23222
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dsec_GM23222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 173 aa AA seqDB search
MFLAKSLVCLALLAVANAQFDTNYASGRSGMVHLFEWKWDDIAAECENFLGPNGFAGVQV
SPVNENAVKDSRPWWERYQPISYKLETRSGNEQQFASMVKRCNAVGVRIYVDVIFNHMAA
DGGTYGTGGSTARHQHPELSWSALFLAGLLLDLRPSTTTRRQPSAQLRAGRSA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtttctggcaaagagcctagtgtgcctcgccctcctggcggtggccaacgcccaattc
gacaccaactacgcctccggtcgtagtggaatggtccacctcttcgagtggaagtgggac
gacatcgctgccgagtgcgagaacttcctgggacccaatggcttcgccggcgtccaggtc
tcgcctgtgaacgagaacgccgtcaaggacagccgtccctggtgggaacgttaccagccc
atctcctacaagctggagacccgctccggaaacgagcagcagttcgccagcatggtcaag
cgttgcaacgctgtgggagtgcgcatctacgtggatgtgatcttcaaccacatggccgcc
gacggaggcacctacggcacgggcggcagcaccgcccggcaccagcaccctgagctatcc
tggagtgccctattcctcgctggactgctactcgacttgcgcccatcaacaactacaaga
cgccaacccagtgcgcaactgcgagctggtcggtctgcttga

DBGET integrated database retrieval system