KEGG   Drosophila sechellia: Dsec_GM23291Help
Entry
Dsec_GM23291      CDS       T01064                                 

Definition
GM23291 gene product from transcript GM23291-RA
Orthology
K10739  
replication factor A2
Organism
dse  Drosophila sechellia
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:dse03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dse03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dse03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dse03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:dse03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 246 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLDPKQQAVFQAIKSNVSEEGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcatttggagatttcaatgccacacaaactgcgcccgctggagccgccagc
aatcaaaagggagaaggaatagtgcccctggtggtgaagcagattgtggacgccccggag
ggaaacatcgagttgttcggcatgcagtacgccatggcctgtgttgtggccatagtgcga
aacgtggagacttcctcgacgaagatcacctatacactggaggatcatagcggcaggatc
gatgcgcactactggctggaggagggcgacgctctcaaggcacccgaggtcatggtcaac
aactacgtgaaggtctacggcaccacccggtcgcaaggcggttccaaaaccctaatgata
ttcaagctactgcccgtcttggatcccaacgaggtgtgcacccacctgctggaagtactc
aatgcccgctacagggccgaggactaccagagcaagggtggagctggagctggtgcaggg
gcttcttccggctcaggctccatagctgatttcaccgcctcccagagctcggccattgtc
agtgggctagatcccaagcagcaggccgtcttccaggccatcaagagcaatgtttccgaa
gagggcatctcccgcaagcaactgaaagccaaattctcccacatcagcgactctgagttg
accaacattctggactttatgatttccgagggacacatttattccagcattgacgcagat
cactttatttgcacaatgtaa

DBGET integrated database retrieval system