KEGG   Drosophila sechellia: Dsec_GM23325Help
Entry
Dsec_GM23325      CDS       T01064                                 

Definition
GM23325 gene product from transcript GM23325-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dse  Drosophila sechellia
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsec_GM23325
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsec_GM23325
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dsec_GM23325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 421 aa AA seqDB search
MRLKSGVLSVLLLTTFLALGECFWPFSKWHGTNDNPSAPPEPKLSPVIFVPGDGGSQMDA
RLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETR
IPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLGYIRRQNIHGAPYDFRKAPNENQQFF
IDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGS
FKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPSRNYTMA
QLEEFFKDLDYMTGWEMRKDTIRYNRNFNPPNVELHCLYGDGIDTVERLQYKKSDISAET
PKLIMGLGDGTVNQRSLRACKYWAGYSNAPINTLALQNVDHMHILSNPDVLKYIRTVMQQ
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaaatcgggagtgctttcggtgctcctgctgaccaccttcttggccctgggc
gagtgcttttggccatttagcaaatggcatggaacaaatgataatccttctgcgccccct
gaacccaagctgtcgccagtgatattcgtacccggcgacggaggctcccaaatggatgct
cggctaaataagcccaactctccctacttaatttgccaaaagacccacgactggtacaac
ctgtggctggacctggagcagttggtcatccccatggtctactgttggatagacaatgtc
aagctgtactacgacaaggtcacgaggaccacacacaacactcctggtgtggagacgagg
atacccggctggggcaatcccgaggtggtcgagtggatcgatcccaccaagaacagcgcc
ggagcctacttcaaggatatagccaatgagctggtgaaacttggatatattcgcagacaa
aacatccacggagcaccctatgacttccgcaaagcgccaaatgagaaccaacagttcttc
atcgatctcaagcagctggtggaggactcctatgaggccaacaatcagtcggctgtcacc
ttcatctcgcacagcatgggcagtctaatgaccctggtgttcttgcaggagcaaaccctc
caatggaaggcgaaatacgtgaagcgcatgatcagcctagcgggagtttgggcgggaagt
tttaaggctgtgaaggtgtttgccatgggcgatgatctcgactcgttcgccctgagtgcc
aagatcctcaaggcggaacagataacacacccatccacggcctggttgctgccctcgcca
ctgttttggaagccatccgaggtgctcgccatgaccccaagcagaaactatacgatggca
cagctggaagagttcttcaaagacctcgactacatgacgggctgggaaatgcgcaaggac
acgattcggtacaaccgaaacttcaatccaccgaatgtggaactgcactgtctctatggc
gatggcatcgacacggtcgagagactgcagtacaagaaatcggacattagtgcggaaacg
cccaagttgataatgggtctcggcgacggcactgtcaaccagcgttctctgcgagcctgc
aagtattgggccggctactccaatgcgcctataaacacgctggccctccagaacgtggac
cacatgcacatcctgtccaatccggacgtcctcaaatatatccgcactgtcatgcagcag
ccgtaa

DBGET integrated database retrieval system