KEGG   Drosophila sechellia: Dsec_GM23412Help
Entry
Dsec_GM23412      CDS       T01064                                 

Definition
GM23412 gene product from transcript GM23412-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dse  Drosophila sechellia
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dsec_GM23412
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dsec_GM23412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MALKMRIAIIGQSNFAADVLELLLDRPNIQIVGVFTIPDRGSREDILATTAIIHNIPVFK
FACWRRKGVALPEVLEQYKSVGATLNVLPFCSQFIPMEVIDGALLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDTIYKRFLYPEGVKA
MGVAVDMVASGVAPKIIQTEVGATYDPAMFKTENQVINLQATAEKIWNFVRGLDSVPGAI
ATVLHENGTEEQIRLFGAHLYSAGPVSKGKFLRLRGLTKTAWIHSGGLLIEGTDGAFVNI
RRIKRGTKVINASEWFKQAEDQSITDFSEDELVKRSLVAGIWKAILKEDVDSSTDFFASG
AGSMDVVRLVEEVKETFDVPLQNEQVFMAPVFEEFFSLLVRFLRQGSAYSDDQQLNFQAF
TLKANKREIRVPTQLFINGEFVDADSQRTLEIVNPTNEEVLCRVACASATDVDKAVQAAH
SAFYGSWRQITPRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVRAGFPPGVINVLPGKGSDAGQAVADHELVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDMDKAVRHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGA
KLVYGGCRVPHLKGYFFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDVDSLMQRANR
TEYGLASGVFTKDIGKALNFADRIEAGTVFVNLYNKTDVAAPFGGFKQSGYGKDLGQEAL
NEYLKTKCVTVEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaaatgagaatcgcaattataggacagagcaattttgctgctgatgttctg
gagcttctgttggatcgcccaaatatccaaattgtaggagtcttcactattccagataga
ggcagtcgagaggacattttggccactactgctatcatccacaatatacctgttttcaag
ttcgcatgctggcgtcgcaagggcgtggcactacctgaggtcttggaacaatacaagtcc
gtgggggctaccctgaatgtgttgcccttctgttctcaattcattcccatggaggtgatt
gacggggcgctattgggcagcatttgttaccacccgtctattctcccacgtcaccgcgga
gctagtgctatatcgtggacactgatcgaaggggacgaggtggccggcttcagcatcttt
tgggcagatgacggtcttgacacaggacccctgctgctaacccgacaaacaaacctggaa
cccacggacacgctggacactatatacaagcgctttttgtaccccgaaggtgtaaaggcg
atgggtgtcgccgtggacatggtcgctagtggtgtggcacccaagataatccagacggaa
gtgggggcaacctacgacccggctatgtttaaaacagaaaatcaggttatcaatcttcag
gctacagcagaaaaaatttggaactttgttcgtggtctggactcagttcctggagccata
gcaacggttctacatgagaatggcacagaggagcaaattcgactatttggtgctcatttg
tactctgctggccccgtgtcaaaaggaaaatttctacgtctaaggggcctaacaaagacc
gcctggatacacagcggtggtcttcttatagagggaaccgacggtgcctttgtcaacatt
cgccgcattaagcgtggcacaaaggtaataaatgccagcgagtggtttaagcaagctgag
gaccagtctattactgacttcagcgaggacgaattggtgaagcgatcgttggtggccgga
atttggaaggcaatacttaaggaagatgtcgactcatcgactgatttctttgcatccgga
gctggttcaatggacgtggtacgcttagtcgaggaagttaaagaaacctttgacgtgccg
ctgcagaacgagcaagttttcatggcgcctgtgtttgaggaattttttagcctgctggtt
aggttccttcgacagggaagtgcctattccgatgaccagcagctcaactttcaggcattc
acgctgaaagccaacaaaagagagattcgagtgcccacacaactttttataaacggagag
tttgttgacgccgattctcaacgcactttggaaattgttaaccccactaatgaggaagtg
ctttgtagagtggcatgcgcctcggccaccgacgtggacaaggcagtgcaagcagcccat
tctgccttttatggatcttggaggcagataacacccagacaacgaggccagttgatgctc
aatttggctgatctgatggaacgcaataaggaggagctggccacaattgagtcagttgat
tcgggagcggtttacactctagcccttaaaacccacgttggaatgtccatcgaagcgtgg
cgctactttgccggatggtgcgacaagatccagggcaacacaatccctgttaaccctgcg
agacccaacaacgtactgaccttcacccgtaaggagccaattggtgtgtgcggtttaata
acgccttggaactaccctctgatgatgctttcatggaaaatggccgcctgcattgccgcc
gggaatacctgtctcattaagcctgctcagacctgccccctgaccgctctaaagtttgca
gagctaactgtccgagccggattcccccccggcgtgatcaatgtcctgcctggaaaaggt
tcagatgcgggccaggcagttgcagatcatgagctggtccgcaaactggggtttaccggg
tccacacccattggcaagcacattatgaagtcatgcgcagactccaaccttaaaaagtgc
tccctggagctgggcggtaagagcccgcttattatctttgcagattgtgatatggacaaa
gccgtcagacacggcatgtcctcggtattttttaataaaggagaaaactgcatcgccgcg
ggacggcttttcgtggaggatcggatacacgatgaatttatccgacgcgttcttaaggat
ctgcgcaccatgaccatcggggacccgcttgaccgctcgacggcccacgggcctcagaac
cacaaggcgcactttgacaaacttctggagttttgtagacgtggggtagacgagggcgcg
aagctggtgtacgggggatgtcgagtcccacaccttaagggatatttctttactcccaca
gtgttcacgaacgttacggacgatatgttcattgcccaagaggagtcctttggaccgatt
atgataatatccaagttcaacggcagcgatgtagattccttgatgcagcgggctaatcgc
acggagtatggcttggccagtggcgttttcacaaaggatattggcaaagcgcttaacttt
gctgatcgcattgaggccggcactgtgttcgtcaatttatacaataagactgatgtggca
gctccatttggtggctttaagcagagcggttatggcaaggacttggggcaggaggcgctc
aacgagtaccttaagaccaagtgtgtcacagttgaatattag

DBGET integrated database retrieval system