KEGG   Drosophila sechellia: Dsec_GM23469Help
Entry
Dsec_GM23469      CDS       T01064                                 

Definition
GM23469 gene product from transcript GM23469-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dse  Drosophila sechellia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dsec_GM23469
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dsec_GM23469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MSTAVLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIR
PVGEPGANTLELVEELKLEVTPLRRSHVAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTK
PLYKAVLRDLFTASKKAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMEGLFEKEQKYGGVLKGTLISRFEKNKTKDTKDGLFAEGQPKLYAQALKEKWAMYGLQG
GLENLPKTMRKYLGERDVNVQLSNECRNLTFSSSGVRMNIKDAEVPVEHVVSSLPAYKLA
PLVKQQHPSLSAQLLSIPYVDVLVVNMQFPGKLLKQDGFGLLVPPVEKLPLLGVIFDSCC
FDMGENTVLTVMMGGHWFDQWFGDRPSPKQILDLATSHVQKMLQIREEPKFSRVHTLHKC
IPQYTVGHKRRVEAIRNYIKTYKLPLSVCGAAYDGVGINDVILSARRQVEAIPLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggccgtgctgggaggcggactgagtggactgtccgccggatactacctgttg
cggcgattcgggaagccgctgaccatctacgaggcctcgccccgtgtgggcggatgggtg
cggtcggagaatcgaaaggatcgcaacttcatcttcgagagcggaccgcgaaccatacgc
ccagttggcgagccaggtgccaatacgctggaactggtggaggagctgaagctggaggtg
actccccttcgacgcagtcatgtggcagcacgcaaccgaatgctgtatgccaagggacag
ctgtgcatgctgcccaacagtcctaagggtctcttcggcgtcctacctcccttcacgaag
ccgctatacaaagcggtgctccgcgatctgttcacggcaagcaagaaggccaagctggag
gatgagagcatctacagtttcgctgagcggcggtttggtaaggagatagccgactacgcc
atcagtcccatgatctgtggtatttgcgccggtgacgcgcgagaaataagcgtgcgcttc
ctgatggagggactctttgaaaaagagcagaagtacggaggagtgcttaagggcacactc
atttctcgctttgagaagaacaagaccaaggacaccaaggatggactgtttgccgaggga
cagccaaagctgtatgcgcaggcgttgaaggagaagtgggccatgtacgggctgcaaggc
ggtctggagaacctacctaaaactatgcgaaagtatctaggcgagcgggatgtgaacgtg
cagctaagcaacgaatgccggaacctgaccttcagcagctctggggttcgaatgaacatc
aaggatgccgaagttccggtggagcatgtggtcagctccctgcccgcctacaagctggcg
cccctggtaaagcagcagcatccctcgctgagcgcccaacttttgagcatcccgtacgtg
gatgtgctggtagtgaacatgcagttccccggcaagctactcaagcaggacggatttgga
ttgctagtaccgccagtagaaaagttgcctctgctgggcgtcatcttcgacagctgctgc
ttcgacatgggcgagaacactgtgcttaccgtgatgatgggtggtcattggttcgaccag
tggttcggcgatcgtcccagccccaaacagattctagacttggccaccagccatgtgcag
aaaatgctgcagatccgcgaggaacccaaattcagtcgagtgcacacactgcacaagtgc
atcccgcagtacactgtgggccacaagcggcgcgttgaggccattcggaactacatcaag
acttacaaacttccactgtctgtctgcggagcagcttacgatggcgtgggcatcaacgat
gttatcctgtccgcccggcgacaagtggaggccatacccttgtcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system