KEGG   Drosophila sechellia: Dsec_GM23469Help
Entry
Dsec_GM23469      CDS       T01064                                 

Definition
GM23469 gene product from transcript GM23469-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dse  Drosophila sechellia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dse00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MSTAVLGGGLSGLSAGYYLLRRFGKPLTIYEASPRVGGWVRSENRKDRNFIFESGPRTIR
PVGEPGANTLELVEELKLEVTPLRRSHVAARNRMLYAKGQLCMLPNSPKGLFGVLPPFTK
PLYKAVLRDLFTASKKAKLEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMEGLFEKEQKYGGVLKGTLISRFEKNKTKDTKDGLFAEGQPKLYAQALKEKWAMYGLQG
GLENLPKTMRKYLGERDVNVQLSNECRNLTFSSSGVRMNIKDAEVPVEHVVSSLPAYKLA
PLVKQQHPSLSAQLLSIPYVDVLVVNMQFPGKLLKQDGFGLLVPPVEKLPLLGVIFDSCC
FDMGENTVLTVMMGGHWFDQWFGDRPSPKQILDLATSHVQKMLQIREEPKFSRVHTLHKC
IPQYTVGHKRRVEAIRNYIKTYKLPLSVCGAAYDGVGINDVILSARRQVEAIPLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggccgtgctgggaggcggactgagtggactgtccgccggatactacctgttg
cggcgattcgggaagccgctgaccatctacgaggcctcgccccgtgtgggcggatgggtg
cggtcggagaatcgaaaggatcgcaacttcatcttcgagagcggaccgcgaaccatacgc
ccagttggcgagccaggtgccaatacgctggaactggtggaggagctgaagctggaggtg
actccccttcgacgcagtcatgtggcagcacgcaaccgaatgctgtatgccaagggacag
ctgtgcatgctgcccaacagtcctaagggtctcttcggcgtcctacctcccttcacgaag
ccgctatacaaagcggtgctccgcgatctgttcacggcaagcaagaaggccaagctggag
gatgagagcatctacagtttcgctgagcggcggtttggtaaggagatagccgactacgcc
atcagtcccatgatctgtggtatttgcgccggtgacgcgcgagaaataagcgtgcgcttc
ctgatggagggactctttgaaaaagagcagaagtacggaggagtgcttaagggcacactc
atttctcgctttgagaagaacaagaccaaggacaccaaggatggactgtttgccgaggga
cagccaaagctgtatgcgcaggcgttgaaggagaagtgggccatgtacgggctgcaaggc
ggtctggagaacctacctaaaactatgcgaaagtatctaggcgagcgggatgtgaacgtg
cagctaagcaacgaatgccggaacctgaccttcagcagctctggggttcgaatgaacatc
aaggatgccgaagttccggtggagcatgtggtcagctccctgcccgcctacaagctggcg
cccctggtaaagcagcagcatccctcgctgagcgcccaacttttgagcatcccgtacgtg
gatgtgctggtagtgaacatgcagttccccggcaagctactcaagcaggacggatttgga
ttgctagtaccgccagtagaaaagttgcctctgctgggcgtcatcttcgacagctgctgc
ttcgacatgggcgagaacactgtgcttaccgtgatgatgggtggtcattggttcgaccag
tggttcggcgatcgtcccagccccaaacagattctagacttggccaccagccatgtgcag
aaaatgctgcagatccgcgaggaacccaaattcagtcgagtgcacacactgcacaagtgc
atcccgcagtacactgtgggccacaagcggcgcgttgaggccattcggaactacatcaag
acttacaaacttccactgtctgtctgcggagcagcttacgatggcgtgggcatcaacgat
gttatcctgtccgcccggcgacaagtggaggccatacccttgtcctaa

DBGET integrated database retrieval system