KEGG   Drosophila sechellia: Dsec_GM23509Help
Entry
Dsec_GM23509      CDS       T01064                                 

Definition
GM23509 gene product from transcript GM23509-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dse  Drosophila sechellia
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsec_GM23509
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsec_GM23509
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dsec_GM23509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MSKFVKVAINERLWEFPDIYEFVCFLGGGSFGQVAKVRLRGTENYVAMKRLMHPFEREED
AKGAYREIRLLKHMNHRNVISLLNVFHPPGHNMMDFKQVYLVTHLMDADLHRYSRSKRMS
DNEIRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADNMTDYV
GTLWYRAPEIIFLRGQYTKAIDVWSVGCILAELITGRVLFPGENYPSQIRCLIDIIGTPT
REFITGISMEKSRSFLERYPLRQRCDFHHLFMGTDVQAVDLMEKMLEMVPEKRITAAEAM
LHPYLRDLIEPHHHAEDTAPVYDQNFENLVLPVKCWKELVANEIRNF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagttcgtgaaagtggcaattaacgaacgcctttgggagttccccgacatatac
gagttcgtttgttttctgggtggcggttcctttggccaggtagctaaggtgagactacga
ggcaccgaaaattacgtcgctatgaaaaggcttatgcacccattcgagagggaggaggat
gctaagggtgcctatcgcgagatccgtctgctgaagcatatgaatcatagaaatgttatc
agcctgctgaacgtctttcatccaccagggcacaacatgatggattttaagcaggtttat
ttggtgactcacctgatggacgcggacctgcacaggtactcgcgttcgaaaaggatgagc
gacaatgagattaggataatcctttaccaaatactgcgggggctgaagtacatacacagt
gccggggttgttcatcgtgacttgaagccctgcaatatcgcagttaatggaaatagcgag
gtgcgcatacttgacttcggtttatcccgtatgtgcgcagacaatatgacggactatgtg
ggaactctgtggtatcgagctccggaaattatcttcctcaggggtcagtacacaaaggca
atcgacgtgtggtcggttggttgcattctggcggaacttatcacggggcgtgtcctgttc
cccggtgaaaactatccaagccaaatacgatgtctgattgacataatcggtactccgacg
agggagtttatcaccggaataagcatggaaaaatcgcgtagcttcctggagaggtatccg
ttacgccaaaggtgtgattttcaccacctatttatgggtaccgatgtccaggctgtcgat
ttgatggaaaaaatgctcgaaatggttcccgaaaaacgcataacagctgcggaagcaatg
ctccatccataccttcgggatcttattgagccacaccatcatgccgaagacaccgcacca
gtctatgatcagaacttcgaaaacctagtgctgcctgtaaaatgctggaaggaacttgtt
gccaacgagattcggaacttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system