KEGG   Drosophila sechellia: Dsec_GM23509Help
Entry
Dsec_GM23509      CDS       T01064                                 

Definition
GM23509 gene product from transcript GM23509-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dse  Drosophila sechellia
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dse04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MSKFVKVAINERLWEFPDIYEFVCFLGGGSFGQVAKVRLRGTENYVAMKRLMHPFEREED
AKGAYREIRLLKHMNHRNVISLLNVFHPPGHNMMDFKQVYLVTHLMDADLHRYSRSKRMS
DNEIRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADNMTDYV
GTLWYRAPEIIFLRGQYTKAIDVWSVGCILAELITGRVLFPGENYPSQIRCLIDIIGTPT
REFITGISMEKSRSFLERYPLRQRCDFHHLFMGTDVQAVDLMEKMLEMVPEKRITAAEAM
LHPYLRDLIEPHHHAEDTAPVYDQNFENLVLPVKCWKELVANEIRNF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagttcgtgaaagtggcaattaacgaacgcctttgggagttccccgacatatac
gagttcgtttgttttctgggtggcggttcctttggccaggtagctaaggtgagactacga
ggcaccgaaaattacgtcgctatgaaaaggcttatgcacccattcgagagggaggaggat
gctaagggtgcctatcgcgagatccgtctgctgaagcatatgaatcatagaaatgttatc
agcctgctgaacgtctttcatccaccagggcacaacatgatggattttaagcaggtttat
ttggtgactcacctgatggacgcggacctgcacaggtactcgcgttcgaaaaggatgagc
gacaatgagattaggataatcctttaccaaatactgcgggggctgaagtacatacacagt
gccggggttgttcatcgtgacttgaagccctgcaatatcgcagttaatggaaatagcgag
gtgcgcatacttgacttcggtttatcccgtatgtgcgcagacaatatgacggactatgtg
ggaactctgtggtatcgagctccggaaattatcttcctcaggggtcagtacacaaaggca
atcgacgtgtggtcggttggttgcattctggcggaacttatcacggggcgtgtcctgttc
cccggtgaaaactatccaagccaaatacgatgtctgattgacataatcggtactccgacg
agggagtttatcaccggaataagcatggaaaaatcgcgtagcttcctggagaggtatccg
ttacgccaaaggtgtgattttcaccacctatttatgggtaccgatgtccaggctgtcgat
ttgatggaaaaaatgctcgaaatggttcccgaaaaacgcataacagctgcggaagcaatg
ctccatccataccttcgggatcttattgagccacaccatcatgccgaagacaccgcacca
gtctatgatcagaacttcgaaaacctagtgctgcctgtaaaatgctggaaggaacttgtt
gccaacgagattcggaacttctga

DBGET integrated database retrieval system