KEGG   Drosophila sechellia: Dsec_GM23515Help
Entry
Dsec_GM23515      CDS       T01064                                 

Definition
GM23515 gene product from transcript GM23515-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dse  Drosophila sechellia
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dse03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dse04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 223 aa AA seqDB search
MSMEKVANKQYETKNWPDIVDSDDSDVDNEIDVDNLPPLEVGPGENRLQHTYCLWFSRKE
TQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANS
KGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPEDSLAVWHRTATDM
TSTTRIRDTLRRILNIPLTTAMEYKIHCDSLKYVSNNKGPLKS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagaaagtagccaacaagcagtacgagacgaaaaactggccagatatcgtc
gacagcgacgacagcgatgtggataacgaaatagatgtggacaacctgccgccactggag
gtgggtcccggcgagaaccggctgcagcacacatactgcctctggttctctcgcaaggag
acgcagcgggcggccgccgactacagcaagtcgctgcacatggtcggccggtgcgccagc
gtgcagcagtggtggtcgctctactcgcacctcatccggcccacagccctgaagccctac
cgggagctcctcctcttcaagcagggtatcataccgatgtgggaggacccggcgaacagc
aagggcggacaatggttgatacggctgcgcaagaacaaggtcgaccgggcctgggagaac
gtttgtatggcgatgctcggggagcagttcctcgtcggcgacgagatatgcggagtcgtg
ctacagacgaaatatccggaggatagcttagcagtatggcaccggactgccactgatatg
accagtacaacacgtatccgtgatacgttacgcaggatattaaatatacctctaacaacg
gcaatggagtataagatacactgtgatagccttaaatatgtttcaaataataaaggccca
ttgaaaagctga

DBGET integrated database retrieval system