KEGG   Drosophila sechellia: Dsec_GM23844Help
Entry
Dsec_GM23844      CDS       T01064                                 

Definition
GM23844 gene product from transcript GM23844-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dsec_GM23844
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dsec_GM23844
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dsec_GM23844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 604 aa AA seqDB search
MPARCGCLKKEARVHVIYVGGTIGMIRNESGVLHTEPKVLARQLQEFPSCHDRNYTSKDN
DGPMMVLPAVSGAPYRVLYDLIEFCPLMDSSCMGFCDWKRIANEVGKTYKSYDGFVILHG
TDTLAYSASALAFMLESLNKPVVFTGAQIPIFEARSDGRENFLGALLIAGNYNIPEVLVF
FGNKILRGCRSTKLSSDSFHALDSPNFAPLGRASVNIEINSRQIFRPCNIKPFSLHSELE
KNVALLRIYPGMSASVVQAILKEPTKGVVLQTFGAGNFPVNREDLMDELREAVHRGVIIV
NITQCSAGMVANIYETSQGLMEVGVIPGYDMTQEAAFTKLAYVLSKPEWDIPNKKKVMLL
SLRGELTTNKVAKINDIDLIEGVARTLHMSTAMERQQMCATFYPALVAAAVTEGDVHKLG
DLKQYGANLCDTNCDGRSAMHLACFLGKLNCVCFLISAGCPVNVHDRFNRTPLHEAIDTD
NHDIIKALLKNGAKLNDQPLVQAELLRALTERGKIKRLESFRLAGANLTLADRTGRTALH
YACQLGNHEVVDYLLPHYENPYIKDELGMSPIDYAKAANHAHILTLMRFKEKELAKQDPC
SCTQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaggtgcggttgcttgaagaaggaggctcgcgttcatgtcatctacgtgggt
ggaaccatcggaatgatccgcaacgagtccggagtactgcacaccgagcccaaggtgctg
gctcggcagcttcaagagtttcccagctgccacgacaggaattacaccagcaaggataat
gatggtcccatgatggtgctacccgcagtgtctggagctccgtatagagtcctttacgat
ttgattgagttctgcccacttatggactccagctgcatgggcttctgcgactggaagcgc
attgccaacgaagtgggaaagacatacaagtcctacgacggctttgtgatcctccatgga
acggataccttagcatactccgcctcggcactggcgttcatgctggagagcctgaacaaa
cccgtggtattcactggggcacagattccgatctttgaagcccgcagcgatgggcgggaa
aacttcttgggcgcacttctcatagcaggcaattacaatatacccgaggtgctggtattc
ttcggcaacaagattctacgtggctgtcgctccacgaagctcagttccgactcctttcac
gcactggactcaccaaattttgccccattgggtcgggcgagtgtcaacattgagataaac
agccgccaaatctttcgaccgtgcaatattaaaccattttcacttcattcggaactcgaa
aagaacgtggcgctgctgcgaatttacccgggaatgagtgccagtgtggtccaggcaatc
ctgaaggagccaacgaaaggtgtggtcctccagacctttggagccggcaattttccggtt
aatcgtgaggacttgatggacgaactgagggaggcggttcacagaggcgttattattgtc
aacatcacgcagtgctcggcgggcatggtggccaacatttacgagacaagccagggcctg
atggaagtgggcgtaattcccggctacgatatgactcaggaggccgcctttaccaagctg
gcctatgtgctgtccaagccggagtgggacattcccaacaagaagaaggtgatgctacta
agtttgcgcggcgagctgaccaccaataaggttgccaagattaacgatattgatctgatc
gagggcgtggcccgcacattgcacatgtcgacggcgatggaacggcagcagatgtgcgcc
acattctatcccgctttggtggcggccgcggtcaccgaaggtgatgtccacaagttggga
gatctcaagcagtacggcgccaatctgtgcgacaccaactgcgatggtcgctccgccatg
cacctggcctgcttcctgggcaaactgaactgtgtttgcttcctgatttccgccggttgt
ccggtaaatgtccacgatcgattcaaccgcacgccattgcacgaggccatcgacacggac
aaccatgatataatcaaggcgctgctcaagaacggtgccaagctaaacgatcagccgctg
gtccaggcggagctactgcgtgcccttaccgaacggggcaagatcaagcgattggagtca
tttcggctggccggagccaatctcacgctggccgatcggactggacgaacggctctgcac
tacgcctgccagttgggcaatcacgaggtggtggactatctgctgccgcactacgagaat
ccctacatcaaggatgagctgggcatgtcgccaatcgactacgccaaggctgccaatcat
gcccacatcctgaccctgatgcggttcaaggagaaggagttggccaagcaagatccgtgt
tcctgcacgcaatag

DBGET integrated database retrieval system