KEGG   Drosophila sechellia: Dsec_GM23905Help
Entry
Dsec_GM23905      CDS       T01064                                 

Definition
GM23905 gene product from transcript GM23905-RA
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
dse  Drosophila sechellia
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dsec_GM23905
Enzymes [BR:dse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dsec_GM23905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 219 aa AA seqDB search
MVESEPAPNDDYEHPDGLEYILESVLMPSDGSKEFKCLADEYNSVLLNPCHCKGACENSE
VCPHAGQYEFTGDGSELILRNSANPVIDLICCINTCSNRLVYSGPRKHLEIFDSPEYGSK
GLRSTVKIPKGGYICEYAGELLTVPEAKRRVHVNEKLGLMNYVLVLNEYTSDKKQQVTIV
DPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGKFYC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaatctgaaccagctccgaatgacgactatgagcacccagatggactcgaatac
atattggaatctgtgttgatgcctagcgatggaagcaaagaattcaaatgtttggcggac
gagtacaattctgttcttttgaatccctgtcactgcaaaggagcctgcgaaaacagcgaa
gtctgtccacatgcaggccaatatgagttcacaggagatggcagcgaattaattcttcgg
aattccgcaaatcctgtcattgatttaatttgctgtataaacacctgctccaatcggctt
gtgtactcaggcccgaggaaacatttggaaatattcgattcgcctgagtacggatccaaa
ggacttcggtctacagtgaaaattccaaaaggaggatacatctgcgagtatgctggagaa
cttttaacagttccagaggcaaaacgacgcgtgcatgttaatgaaaaacttggcctgatg
aactatgtcctggttcttaatgaatacactagcgacaagaagcaacaggtgaccatcgtt
gatccatcaagacgtggaaacatcggacgctacctgaaccacagctgcgaaccgaactgt
catatagcagctgtacgaatagactgtcccataccaaaaataggcaagttttattgctga

DBGET integrated database retrieval system