KEGG   Drosophila sechellia: Dsec_GM23935Help
Entry
Dsec_GM23935      CDS       T01064                                 

Definition
GM23935 gene product from transcript GM23935-RA
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dse  Drosophila sechellia
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:dse01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dse00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dse00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 451 aa AA seqDB search
MRALRSNEVKRCIRQYSRLVACAAQQQQFLRQDGSNRCQEATRLLTWQGIHTTSSMWSEQ
TVNVPPFADSIAEGDIKFTCKVGDSFAADEAVMEIETDKTTVAVPAPFSGTLTDILVKDG
DTVKPGQALFKIKPGAAPAKAAAPAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPP
PPPKAAPRPPPPAPVAALKPAVAQVKVPPADGSRQILGTRSEQRVKMNRMRLKIAARLKD
AQNTCAMLTTFNEIDMSYAMDFRKQNLDAFTKKYGIKFGFMSIFAKASAYALQDQPVVNA
VIDGTDIVYRDYVDISVAVATPRGLVVPVIRNVEGMNYADIEIALAGLADKARRDAITVE
DMDGGTFTISNGGVFGSLMGTPIINPPQSAILGMHGIFDRPIAVKGEVKIRPMMYIALTY
DHRIIDGREAVLFLRKVKAAVENPAIIVAGL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccctgcggagtaatgaggtaaagcgttgcatccgccaatattctcggttagtt
gcctgcgccgcccagcagcagcagtttctccgtcaggatggatcgaatcgctgccaggag
gccaccaggcttctcacctggcagggtatccacaccacgtcgagcatgtggtcggagcag
accgtcaatgtgccaccctttgcggactccattgccgagggtgacatcaagtttacttgc
aaggtgggtgactcattcgccgctgacgaggctgtcatggaaatcgagaccgacaagacg
acggtggctgtgccagctcccttctccggaactctgaccgacattctggtgaaggatggc
gacaccgtcaagcccggccaggctctgttcaagattaagcctggtgcagcgcccgccaag
gcagctgctccagcggctgctcctgcgcctgctgccccaaaagctgccccagctcccgct
gctgcacccaagccggcacctccaccacctgccgccggcgcaccaaagccaccaccaccg
ccaccaccaaaggcagcccctcgaccaccaccacctgctccagtggctgcacttaagccg
gccgtcgcccaggtgaaggtgccaccagcggacggatcgcggcagatcctaggcactagg
tccgagcagcgtgtcaagatgaaccgaatgcgtctaaagattgccgcccgcttgaaggat
gcccagaacacatgtgctatgctcaccactttcaacgagatcgatatgagctatgccatg
gacttccgaaagcagaatctggatgcgttcactaagaagtatggtattaaatttggattc
atgtcgatcttcgcaaaggctagtgcctatgctctgcaggatcagcccgtagtgaacgcc
gtcattgatggcacggacatcgtgtatcgcgactacgttgacatctctgtggccgtggct
acgccccgtgggttggtggtgcccgtcatccgcaacgtggagggcatgaactatgccgac
atcgagatcgcactggccggtctggccgataaggccaggcgggatgccatcaccgtggag
gacatggacggtggtaccttcaccatcagcaatggcggagtgttcggatccctgatgggc
acgcccatcatcaatccgccacagagtgccattctcggcatgcacggcatctttgatcgg
ccaattgctgtcaagggagaggtcaagatacgtcctatgatgtacatcgccctgacctac
gatcaccgaatcattgatggacgtgaggcggtcctgttcctgcgaaaagtaaaggctgct
gtagagaacccagcaattattgttgccggattgtaa

DBGET integrated database retrieval system