KEGG   Drosophila sechellia: Dsec_GM23961Help
Entry
Dsec_GM23961      CDS       T01064                                 

Definition
GM23961 gene product from transcript GM23961-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dse  Drosophila sechellia
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dse03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1250 aa AA seqDB search
MERRRFNMSSMSTMADSTRIDASLISNRPAATFLRGLSPKSNTSLNGTRTPERALMNRSV
SSSSSMSRQKLNRSQVDPRTFADVHSSGLTSRIVALSERSGLQRSMSASNLYNPMTQPRR
APGSPLPYKSRAPTLSITQIAPPERSFYSGNTLSSLLRSNSLVGLVQKTSEQEQLSRENR
PILHPPHPQHESEPTRSVLEELKEISRKRINTGDTQHAQDNTKRSCQRSFDFVDHHRHQQ
QIHHLQQQQNQSFKRQRELTVSVPLRHHSTSLSAAPPALQHMHSNGNISPTQSPEQVAKR
RNCSYSNDIASSLSSSFRHSNKRKLLDMRERFQHSKNDTLASGGSSPENSPENVAKIQRK
VDAEAVSKSVSMPVVAVSAVPPSRAISAPAIQKVVPLVTEKPKLTLFNARQSETQVEQPR
HDLSSPEVDAGEYAGIQFVKPKQQNSMLAAKNPSLERTHKTKLAIMLSGLKGELYQGEPD
ELDAPAPKSAASPATLPTPIKPIIIAPVTTSTTAVISTATISTAPSKPVILSNQVIKPAD
VPKTISTGSVPKLVLGKPAPPAKTEQTPPKPIDKVPAGQADIPAKFELSTKPVTPATSAQ
PLISFGTPKSTAAPSFSFGTATNTSSSTTTNTTNTTTSKPIFSFGQTPANGPTVGGLSVF
KTDTPATTSVSTTNPGTPVTSTITFGVTPPKTTTTVAPTTTVSLSFGQPNSATLVATSKS
TTTATMPSFEAANTAVKPMFSFGKSNNLSSGTPTNKGSDAAAAKPALFSFGGTTTQPAAA
AAAPTPVFGSLSKPLAGGFASPGANKSETTKPGIFGNLDNGLGNVMKPPANVAATTAAEL
PKPFGFAATTTAAGGGSTATNLFAFGGTATSKAAEPAPASQKNLFGQNATTTTPFAFGGA
AAAIAGKSENKDNKPFAFGGGDNNAVAKPSGVFSFGGTDKSAPPAFGSGTTSVTSATATP
TNNTFGFGTAQKPATPMFGSGSTQQSSTPAVAATKPFTFGGRAPQAPTTPSASPASGGFS
FSAVAAKNTTAPTAETNMFGSPASASKSSFNFGGNTATQAPAAGSPAGGFSFAAAIKKED
PASTNMFGSPNTGVVKPNFGFSSTNPTPAPTFGGFGAPAAAAPTATSTNQSKPFAFGAST
PAAAPSAAPLGGNLFANAVSSTQNQTKPPGVFSFGTAKSTAGTTAGNAPFSFGGASAGGI
ASPPSNQGLNTAKPFSFGGAGGTPAPNVFGSPAPAPPVSNPAGGFNFRRR
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgtcgctttaacatgagcagcatgtcaaccatggcggattccacgcggatc
gacgcgtcgctgataagcaatcgtccggcggccactttcctgaggggactgagtcccaag
tcgaatacctcgctcaatggcacacgcactccggagcgggccttgatgaatcgctctgtc
tcatcgtccagctccatgtcgcgacagaaactgaaccgcagtcaggtcgatcccagaaca
tttgctgatgtgcacagcagcggactgacatcccggatcgtggccttaagcgaacgcagt
ggtctgcagcgcagcatgtccgccagcaatctgtacaatcccatgacgcagccgcgcaga
gcgcccggttccccgttgccctacaagtcaagggcgccgacactttcgatcacgcagatt
gcaccaccggagcgcagcttttattccggcaacacgctgtcaagcctgttgcgatccaac
tccttggtagggttagtgcaaaaaaccagcgaacaggagcagctttcgagagagaatcga
cccatattgcacccacctcatccacagcatgagagcgagccaactagaagcgtgctggag
gagcttaaggagatctcccgaaagcgcatcaacactggagatacgcaacatgctcaagac
aacacgaaaaggagttgccagcgaagctttgactttgtggaccatcaccgtcatcaacag
caaatacatcatttgcagcaacagcaaaatcagtcctttaaaaggcaacgagagctgacg
gtatcggttccgcttaggcatcattcgacatctttgtcggctgctcctcctgcattgcag
catatgcactcgaatggaaacatctccccaactcaatctccggagcaggtggccaaacgg
cgcaattgtagctacagcaacgacatcgcttcctcgctgagttccagtttccgtcacagc
aacaagaggaagctgttggacatgcgagaaaggtttcagcacagcaaaaacgacacacta
gctagtggaggaagctcgcctgagaactcgcccgaaaatgtggccaaaattcaacgtaaa
gttgatgcagaagctgttagcaaatcagtgagcatgcccgtcgttgctgtgtcggcagtt
cctccttcacgagccatttcggcacctgcgattcaaaaggtagttccgctggtgacggaa
aaacctaagcttacactcttcaatgcgcgacaatctgaaacgcaagtggaacagccgcgg
cacgatttgagtagcccggaagtagatgccggcgaatatgcaggcattcagttcgtaaag
cctaagcagcagaattccatgctggccgccaagaatcctagcttagaacgcactcacaag
accaaactagccattatgctaagtggattgaagggcgaactgtaccaaggtgagccggac
gaactagacgccccagcgccaaagtcagcggcatcgcctgcaacgcttcctactcccatc
aagcccatcatcatagctcctgtaaccacatccacaacggccgttatttccaccgcaacc
atatcaactgcgcccagcaagccggtaatactaagtaaccaggttataaagccggcagat
gtgccaaaaacgattagcactggctcagtgcccaaacttgtgcttggtaagcctgctccg
cccgctaaaacggaacaaacaccaccaaaacccatcgacaaggtcccggcaggacaagca
gatatcccagccaagtttgagctatcaaccaaacccgtcactccagcaacatcagctcaa
ccactaatcagttttggcacacctaaatccacagccgcaccatcattctcatttggaact
gcaaccaatacctctagtagcactactaccaatactaccaatactaccacatcaaagccc
atattctcgttcggacaaacgcctgctaatggtccaacagtaggcggcctttctgtattc
aaaactgacacaccagcaacaacttcggttagcacaactaatcctgggacaccggttaca
tctacaattactttcggagtgacaccacccaaaacgacgactacagttgctccgactaca
actgtttcgctaagtttcggccagccgaattcagcaactttagtcgccaccagtaagagc
accacaacagccacgatgccatcatttgaagcagcaaacacagcggtgaaaccgatgttt
tcctttggtaaatcgaacaatttgagttcaggaactccgacaaacaaagggagcgatgca
gctgccgccaagcccgctctattcagttttggaggtaccaccactcagccagctgcagct
gcagctgcaccgacaccggtattcggaagtctatcaaaacccctagccggaggttttgca
tcgcccggggctaacaaatctgagacaactaagcctggcatctttggcaatttggacaac
ggacttggaaacgtaatgaagccaccagctaatgtagcagccacaaccgccgccgagctt
cccaagccatttggcttcgcagctacaacaaccgctgctggcggaggatcaactgccaca
aatctctttgcatttggagggacggccacttcaaaggcagcggaaccagctccagctagc
caaaaaaacctttttggacaaaatgcaaccacaactacgccctttgcattcggaggagca
gcagcagccatcgcaggtaaaagtgaaaataaggacaacaaaccatttgcatttggcgga
ggtgacaacaacgcggtagccaagccaagtggagtattcagctttggtggcacggacaag
agtgcaccaccagccttcggcagcggaacaacatcggtaacatctgccacagcaacaccg
acaaacaacacctttgggtttggcacggctcagaagcctgcaacacccatgttcggaagt
ggatcaacgcaacagtcttcgacaccggcagtggcagccactaaaccttttacatttggt
ggtagggctccgcaggctcctactacaccgtcagcatctccagcttctggaggattctcg
ttttccgctgttgcggccaaaaatactacggcgccaacagcagaaacaaatatgtttggc
agccccgccagcgccagcaagtcaagctttaactttggaggaaacaccgccacccaggcg
ccggcagcaggatcaccagctggtggcttttcattcgccgcggccattaagaaggaagat
cctgcaagcaccaatatgtttggaagccccaacaccggagtggtgaagcctaactttggc
ttttcaagcaccaatccaactccagcgcctacctttggcggattcggtgctccagcagcg
gctgcaccaacagcaacttcaactaatcagagcaagccctttgcatttggggctagcact
ccggctgctgcccccagcgcagcgcccttgggcggcaatctgtttgccaacgcagtgtct
tctacccaaaaccaaacgaagccgccaggagtcttctcatttggtacggctaagagcacc
gccggcaccacagccggcaatgcccccttctcgtttggaggcgcatctgctggcggcatc
gcctcgccgcccagcaatcagggcttaaataccgcaaagccattcagctttggtggcgct
ggtggcactccagccccgaatgtctttgggagcccagcccctgctccgccagtaagcaat
ccagccggggggttcaactttcggcggcgctag

DBGET integrated database retrieval system