KEGG   Drosophila sechellia: Dsec_GM23989Help
Entry
Dsec_GM23989      CDS       T01064                                 

Definition
GM23989 gene product from transcript GM23989-RA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dsec_GM23989
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Dsec_GM23989
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsec_GM23989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 421 aa AA seqDB search
MSHPSDHVLRPKENAPLRMPEKSATVLNMQKNLLLGKKPNSENMAPASKPLPGSSGAVIR
SAATTERPATKPGLGGSNPIASTEGSNFQKPMVPSVKKTTSEFAAPAPVAPTKKPESLSK
QKTAAASTESTKELGAASSSADKEKTKTETQPQKPKKTWELNNFDIGRLLGRGKFGNVYL
AREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLI
LEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHK
GVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHA
PFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHT
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatccgtctgaccatgtgctgcgtcccaaggaaaatgctccgctcagaatgccg
gaaaaatcagcaaccgtgctcaatatgcagaagaacttgctattgggaaagaagcccaac
agcgagaatatggctccagccagcaagcccttgccaggatcctctggcgctgtgatcagg
agtgcggcgaccaccgagcgtccagctactaagccaggcctaggaggctccaatcctata
gcttccaccgaaggaagcaacttccagaaacccatggtgccgtccgtgaagaagaccaca
tcagagtttgctgctccggctccagtagcacccaccaagaagcccgaatcactttccaag
cagaaaactgctgctgcgagcacggaatccaccaaggaactgggtgcggccagcagctcc
gcagacaaagagaaaaccaagactgaaacccaaccccagaagccgaagaagacctgggag
ctcaacaactttgatattggtcgcctgctcggacgcggcaagtttggcaacgtttatttg
gcgcgcgaaaaggaatcccagttcgtggtggccctaaaagtgctcttcaagcgacagatt
ggcgagtccaatgtggagcaccaggtgcgccgtgagatcgagatacaatcgcacctgcgt
catccgcatatcctgcgtctgtatgcatactttcacgacgacgtgcgcatatacctgatc
ctggagtatgcgccacaaggaacgcttttcaacgccctgcaggcacagccgatgaagcgt
ttcgatgagcgccagtcggccacctatattcaggcgttgtgctcggcgctgctttatctg
catgagcgggacatcattcacagggacatcaagccggagaacttgctgctcgggcacaag
ggcgtcttaaagatcgcagacttcggttggtccgtgcacgaaccgaactccatgcgcatg
acactgtgcggcactgtcgactacttgccacccgaaatggttcagggcaagccgcacacg
aaaaacgtggatctatggagcctgggtgtgctctgctttgagctgctggtgggccacgct
cccttctactcgaagaactatgacgagacctacaagaagattctcaaggtggactacaaa
ctgccggagcacatttccaaggcagcatcacatctcatatccaagctgctggtccttaat
ccgcagcaccgcttaccgctggatcaggtgatggtgcatccttggatactggcgcacacg
cagtga

DBGET integrated database retrieval system