KEGG   Drosophila sechellia: Dsec_GM23992Help
Entry
Dsec_GM23992      CDS       T01064                                 

Definition
GM23992 gene product from transcript GM23992-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dse  Drosophila sechellia
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dse00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dse00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dse00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dse00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dse00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dse04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 622 aa AA seqDB search
MKLSVLVLVALLPLLGAVSANRTFVVDYEKDQFLKDGEPFRFIAGSFHYFRAHPATWQRH
LRTMRAAGLNAVTTYVEWSLHNPRDGVYVWSGIADLEHFIRLAVGEDLLVILRPGPYICA
ERDMGGFPYWLLNKYPGIQLRTADVNYLSEIRIWYTQLFAKMNKYLYGNGGPIIMVQVEN
EYGSFFACDLNYRNWLRDETESHVKGQAVLFTNDGPSVLRCGKIQGVLATMDFGATNDLK
PIWAKLRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITSTFINMLDHGASVNFYMFY
GGTNFGFTAATITMHPMTEAGDPTPKYQALRRIIGRYLPLPNQPVPGPVPKRSYGTVRLT
TCCSLLSQEARARLSTGFVQSAKPKSFEALGQYSGLVLYETWLPSFQRDPSILSVPGLAD
RGYVYVDGEFVGVLARETPVFDLPLSASAGRRLQIIVENQGRINYGRQLNDFKGILRDVR
LDKQVLSNWNMTQFPLESYDNLEQLITQSDEAVRQGFQELKKLRTMLRTGPAIYHGQLDI
QKESDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQVTLYVPAAVLKVGSNRLVVVEY
QQTPTSQELHFRDTPILNARTV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagtgtgctggtcctggtggctctactaccgctgctaggagctgtttcagcg
aatcgcactttcgtggtggactacgaaaaggatcagttcctaaaggatggcgaaccattt
cgattcattgccggttccttccactacttccgtgctcatccagccacctggcagaggcat
cttaggaccatgagagctgcgggtctcaatgcggtgactacctatgtggagtggtcattg
cacaatccgcgggatggcgtttatgtttggagcggcattgccgatctggagcactttata
cgcctggccgtgggcgaggatctgctggtcatcctccgcccgggtccgtatatttgtgcg
gagcgtgacatgggcggctttccctactggctgctaaataagtatccgggcattcagctc
cggacagcagatgtcaattatcttagcgaaattcgcatttggtatacccaactgtttgcc
aagatgaacaaatatctgtatggcaatggtgggccaattattatggttcaggtggagaac
gaatatggctcgttctttgcctgcgatctcaactatcggaattggctacgcgacgagacc
gagagtcatgtcaaaggtcaggcggtgctcttcaccaacgatggacccagtgtgctgcgc
tgtggaaaaatccagggcgtcctagcgaccatggactttggagccacgaacgatctcaag
cccatttgggccaagcttagaaggtatcagccgaagggtccgctggtcaatgcggaatac
tatcccggctggctaactcactggacggagccgatggccaatgttagcacccaatcgata
acctccacttttataaacatgctggatcatggtgccagtgtgaacttctacatgttctac
ggtggcaccaacttcggattcacagctgctacgattacgatgcaccccatgacggaggcg
ggggatcccactcccaaatatcaggctctgcgacgcatcattggccgctatctcccgctg
ccaaatcaacccgtgcccggacccgtgcccaagcgatcctacggaactgtgcgtctaacc
acctgctgtagtcttctttcgcaggaggcgagagctcggctctccaccggatttgtgcag
tccgccaagccgaagagcttcgaggctttgggacagtactctggtttggtgctctacgag
acctggttgcccagtttccagcgggatccgagcatccttagcgttcccggactggcggat
cgaggttacgtttatgtggatggtgagttcgtgggtgttctggccagggaaacacccgtg
ttcgacttgccactcagtgcaagtgccgggcggaggttgcagatcatcgtagagaaccag
ggacgcatcaattacggtcgtcagctgaacgactttaagggcatcctgcgggatgtgcga
ctggacaagcaggtgctgagcaactggaacatgacccaattccctctcgagtcgtatgac
aacctggagcagctgattacccaatcggatgaggcagttcgtcagggcttccaggagcta
aagaagttgcgcacaatgctgcgtactggtcccgccatttaccatggtcaactggatatc
cagaaggagtctgatctggcggacacctatctggacatgtccggctggggcaagggcatt
gtctttgtgaatggcgaaaatctcggcaggtactggcccctggtgggacctcaagtcacc
ctgtatgttccggccgctgtgctcaaggtgggctcaaatcgactggtggtggtggagtac
cagcagacacccacctcacaggagctgcacttccgggatacccccattctgaatgcgagg
accgtttag

DBGET integrated database retrieval system