KEGG   Drosophila sechellia: Dsec_GM24480Help
Entry
Dsec_GM24480      CDS       T01064                                 

Definition
GM24480 gene product from transcript GM24480-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dse  Drosophila sechellia
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dsec_GM24480
  Replication and repair
   03420 Nucleotide excision repair
    Dsec_GM24480
Transcription machinery [BR:dse03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dsec_GM24480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 499 aa AA seqDB search
MADTKSGSGRNSAAGGSGNTVLSPLGQGPANLECKDFQEYLRTRQTPESLEKLYNYPPIC
LAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQAEATSCLTALNVWRVTAI
PGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLDKDSKPRDIAFLDTYAMSRWRCVLHY
MVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFML
QYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLREFGLVFQRKRK
EGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLGL
FTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSCLP
PTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQ
KNGHDDVKRYWKKYSKSGV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgaaatccggtagtggtcggaattcggctgccgggggaagtggaaacaca
gtcctgtcgcccttggggcagggtcctgcgaacttggagtgcaaggactttcaggagtat
ctgcgcacccgccaaacgccagagtcgttggagaagctgtacaactatccgcccatttgt
ttggccgtatttcgggagcttcccgagatagcccggcagtttatcataaggatactgttc
gtggatcagcctgttccacaagcggtggtcacatcatggggtgcccaacgttgtgccaag
gagcaagccgaggctaccagctgcctgacggctttgaacgtctggcgggtcacagccatt
ccgggtggcctttctgcgtgggagctctcgcccaccttcaagaaaagcgtgcgccaagtg
ctgctgggcggcggaaagccttggcctatgaccaacacgctggataaggactcgaagccc
agggacattgcttttctggatacatacgccatgtcccgctggcgctgcgtgttgcactac
atggtcggcaccggaaatcgcaatggcaccgatgcggaggccattagtccggatgccgtt
aggattctgctgcacgctaatctcatgaaacgggatgaacgagacggtatcacaataacc
cggcagggctttcagttcctgctgctggacacgcgagctcaggtgtggcattttatgcta
cagtacctggacacgtgcgaagaaagaggaatcagcctgccagaatgcttgtccatgttg
ttccagctcagtttttcaacgctgggcagagattacagttcggaggggatgaacagtcag
atgctgaccttcctgcagcatctacgggagtttggactagtcttccaacgtaaacgtaag
gagggacgcttctatcccacacgtttggctctgaatgtgacaagcaaggaggcggctgcg
actgcttctgtggccatggatgaggaggccactcaggactgtggctacatcgtggtggag
acgaactaccgagtgtatgcctacactgattctccactccaggtagccgtgttaggtctg
tttacggagctcctctaccgctttcccaatctcgtcgtgggcgtgctaacccgcgattca
gtgcgccaggcgttgcgtggtggtatcacggcggagcagattgtctcgtatctggagcag
tatgcgcatcccaatatgcgcatggtcgagtcagccattcactctaaatcctgcctgcca
cccacagtcgttgatcaaattaagctgtgggaactagagcgaaatcgcttcacctacacc
gaaggcgtgctgtacaatcagttcctctcgcatacagatttcgtaacgctacgagactac
gcccagtcgatccacatgctggtgtggcaaaatgagcgaactcgcacgatggtggtgcaa
aagaatggccacgacgatgtcaagcgttactggaagaaatactctaagagtggtgtttag

DBGET integrated database retrieval system