KEGG   Drosophila sechellia: Dsec_GM24501Help
Entry
Dsec_GM24501      CDS       T01064                                 

Definition
GM24501 gene product from transcript GM24501-RA
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dse  Drosophila sechellia
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsec_GM24501
Enzymes [BR:dse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dsec_GM24501
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dsec_GM24501
  Exosomal proteins of colorectal cancer cells
   Dsec_GM24501
  Exosomal proteins of bladder cancer cells
   Dsec_GM24501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 496 aa AA seqDB search
MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCK
ALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGNPVEYSGGR
QAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALD
SFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDF
NHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTR
IFEFFGMNKEEVPTIRLIKLEEDMAKYKPESNDLSAETIEAFLKKFLDGKLKQHLLSQEL
PEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDI
VIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADSEP
VEETEEEEEAPKKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctgatctgtgcacttttcctggcggcgtcctacgtggccgcttccgccgag
gcggaggtcaaagttgaggagggcgttctggtggcgactgtggacaacttcaagcagctg
attgccgacaacgagttcgtgctggtcgagttctacgccccatggtgcggacactgcaag
gctctggctcccgagtacgccaaggctgcccagcagctggccgagaaggagtcgcccatc
aagctggccaaggtcgatgccaccgtcgagggtgagctggccgagcagtacgcagtccgt
ggctaccccactctgaagttcttccgcagcggcaatcccgtggagtacagcggtggccgc
caggccgctgacatcattgcctgggtgaccaagaagaccggcccaccagccaaggatctg
accagcgtcgctgatgccgagcaattccttaaggacaacgagatcgccatcattggattc
ttcaaggacctggaatcggaggaggccaagaccttcaccaaagtcgccaacgccctggac
tcgttcgtcttcggtgtgagcagcaatgccgatgtgattgccaagtacgaggctaaggac
aatggagtggttctattcaagcccttcgacgacaagaagtccgtgttcgagggtgagctg
aacgaggaaaacctgaagaagttcgcccaagtgcagtctctgcccctgatcgttgacttc
aaccacgaatctgcttccaagatcttcggtggctcgatcaagtcgcatctgctgttcttc
gtgtccagggagggcggtcacatcgagaagtacgtcgatcccctgaaggagatcgccaag
aagtaccgcgatgacatcctgttcgtgaccatctcgtccgacgaggaggaccacacccgc
atcttcgagttcttcggcatgaacaaggaggaggtgcccaccatccgtctgatcaagctg
gaagaggacatggccaagtacaagcccgaatcgaacgatctgtccgccgagaccatcgag
gccttccttaagaagttcctggacggcaagctgaagcagcacctcctttcccaggagctg
cccgaggattgggacaagaaccccgtcaaggtgctggtctccagcaacttcgagagcgtt
gccctggacaagagcaagagcgtgctggttgagttctacgccccatggtgcggacactgc
aagcagctggcccccatctacgaccagctggctgagaagtacaaggacaatgaggacatt
gtcattgccaagatggactccactgccaacgagctggagagcatcaagatctcgtccttc
cccacaatcaagtacttccgcaaggaggacaacaaggtcatcgacttcaacctggacagg
actctcgatgatttcgtcaagttcctcgatgccaacggtgaggtggccgattccgagccc
gtcgaggagaccgaggaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system