KEGG   Drosophila sechellia: Dsec_GM24646Help
Entry
Dsec_GM24646      CDS       T01064                                 

Definition
GM24646 gene product from transcript GM24646-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dse  Drosophila sechellia
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dsec_GM24646
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsec_GM24646
Transcription machinery [BR:dse03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dsec_GM24646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 813 aa AA seqDB search
MSGGPSITLKSQPIDGNNTGNAAAQQQQQAANGAATAGASGAAGSAQNPGHGGAAAGAGS
VPAEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENRHRDV
ESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRVEDED
TKKVYQYLFRLLRQCVLTRQQAVIRGPLGDPPFETPCITKAVLSLVFYKYNHLSTPELQT
MTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQCET
SLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSIITLMPKFLETLRAELLKDDSPI
WDTSYRPSNSFVIQQRKRNQEVATVPIGPSAAGIGGSKRTSVGEPLHKRIKKEPTDRPSS
ENLDDLPADVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLT
KPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFP
SQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSK
DIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKV
RPGLTCFKEGLPSIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSV
RQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNC
RFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccatccataacgctaaaaagccaacccatcgatggtaacaacacgggc
aacgctgcggcgcaacagcagcagcaggcagcgaatggcgcagcaaccgctggtgcatct
ggagccgctggcagcgcccagaatccaggacacggaggagctgcggccggcgctggcagt
gtgccggcagagggaacgcggcagaacagcctgcagcgcattcagcagagaaagcaaaag
gtcttcaatctgcccgtgccacagaaattggccaaattgtcgatgtattccgcttgccag
tcggagggatgccgctgcaccggctggaaaacacctcaggaaaatcgccaccgagacgtc
gagtcttcctactgtccggagttcaacgaggagtgccgcaacaccagctgtcgccattcg
ctgagatcgcacatagcccatctggacaatatatccagttccagcatgaacgagctactg
ggcgccatcatagacatggagaacctattcatgtccatgcagcgcgtcgaggacgaggac
accaaaaaggtgtaccagtacctcttccgtttgctgcgccagtgcgtccttacgcgccag
caggcggtcatccggggtcctctcggcgatccaccattcgagacgccgtgcatcaccaag
gctgtgctctcgctggtcttctacaagtacaatcacctgagcactcctgagctccaaacc
atgaccgaggtggccaagacgttcttgaactttctgaaccactacaactttgaatcgccg
tcgaccaggaggggagatctcacccacgaggatgcctctaactacaaaatcaactacacc
aggtggttggtgttctgccacgtgcccgccttctgtaactccctgcgccaatgtgaaacg
tccctagtgtttggacgaacgctcctgcgcaccgttttccagtgcatgtcgcagcagctg
aaaaagaagtgcatctccgagcgggatcgctttcccgaggacaagcgttcgatcatcacg
ctgatgccgaagtttctggaaacgcttcgcgccgaattgctcaaggatgattcgcccatc
tgggataccagctaccgcccgtcaaattcctttgtcatccagcagagaaagcgtaatcag
gaggtggcaactgtacccattggtcccagtgcagcaggcattggtgggagcaagaggacc
agtgtgggtgaaccgctccacaagcgaatcaaaaaggagcccaccgatcgtcccagcagt
gagaatttggatgacctgcctgcggatgtagtaatgcgcgccatgaaatcggtgtccgag
tcgaagaccaccaacaaagcggaaattctctttccggttaatgtgtcgcgcgatgagaac
gtcaaggcggaggagcagaagcgagccattgagttccatgtggtgggcaattcgctgacc
aaaccggtggacaagcagactgtcttgtggctactgggcctgcagctcgtattcgcctac
cagctacccgagatgccgcgcgagtacatcagccagttggtcttcgacaccaagcacaaa
accctggcgctcatcaaggaaaaccagcccatcggcggcatctgtttccgcccgtttccg
tcgcagggcttcaccgagatcgttttctgcgcggtcaccatgtcggaacaagtgaagggc
tatggcacgcacttgatgaaccacttgaaggactacagcatacagaggggcatcaagcat
ctgctcacattcgccgattgcgatgccatcgggtacttcaagaagcagggtttctccaag
gacatcaaattggcgcgaccagtttatgcgggctacatcaaggagtacgatagtgccact
ctcatgcactgcgagctgcatccaagcattgtgaacacgcagttcatagctgtaattcgc
agtcagagcgagattctgaaggagctaatcgcacaacgccacaacgaggtgcagaaagta
agacccggcctgacctgcttcaaggagggcctgccctcgattcccgtggaatcgattcct
ggtctgcgggagatcggttggaagccgcaaaatcggcctgcgcgctcttcgcgacccctc
gaagagtccaccgatccggagaagctggccacgtcctttgcatctgtgctgcaatccgtg
cgccagcacaccaccgcctggcccttcctgcgcccggtgactgcggccgaggttccggac
tactacgatcacatcaaatatcccatggacctgaagaccatgggcgagcgcctgaagaag
ggttactaccaaacgcgccgcctgttcatggccgacatggcgcgcatcttctccaactgt
cggttttacaattcgcccgacaccgagtattatcggtgtgccaactccctggagcgctac
ttccagaccaagatgcgcgagctggggctgtgggacaaatga

DBGET integrated database retrieval system