KEGG   Drosophila sechellia: Dsec_GM24706Help
Entry
Dsec_GM24706      CDS       T01064                                 

Definition
GM24706 gene product from transcript GM24706-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dse  Drosophila sechellia
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dsec_GM24706
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dsec_GM24706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 313 aa AA seqDB search
MTEFDFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIE
KENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYVDLV
VKVYFKDTHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKH
VTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQK
HPDQFKVWYTVDKANEGWQYSVGYINEEMIAAHLLPAKDDTIVLLCGPPPMINFACNPAL
DKLGYHPDTRFAY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacggaattcgattttgtgccactcgccgtgggtgtggtcgccgtactcgccggcgcc
ctgatcgtccactatctgctgaataagaagtccacgaaaccacgccgggaacccaatcgc
accgctcggctgcgcacgcttgtggatcccaacgacaagtacctgctgcctctcatcgaa
aaggagaatctgagccatgacactaggagattccggttcggattgccctccaagcagcat
gtccttggcctgcccgttggccagcacattcatctgatcgctaccattgacaatgagctg
gtaattcggccatacactccgatatcgtccgatgaggatgttggctatgtggacctggtc
gtcaaggtgtacttcaaggacacgcatcccaagttcccggccggcggcaaaatgacgcaa
cacctggagcaactcgagttgggggacaagatctcgttccgtggtccctcgggtagactg
caatatctcggcaatggcaccttctccatcaaaaagttgcgcaaggatccgcccaagcac
gtgaccgccaagcgagtcaacatgattgccggcggcactggcattactccaatgctccaa
ttggccagggaagtgctcaagcgcagcgataaggataagactgagctggcgttgctgttc
gccaaccagagcgaaaaggacattctgctgcgtgcagagctggacgaattggcccagaag
catcctgaccagttcaaggtctggtacacagtggacaaggcaaacgaaggttggcagtat
agcgttggctacatcaatgaggaaatgatcgccgcccacctgcttccggccaaggacgat
accatcgtgttgctttgcggcccaccacccatgattaactttgcctgcaatccggcgctg
gacaagcttggctaccatccggacacccgttttgcctactaa

DBGET integrated database retrieval system