KEGG   Drosophila sechellia: Dsec_GM24735Help
Entry
Dsec_GM24735      CDS       T01064                                 

Definition
GM24735 gene product from transcript GM24735-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dse  Drosophila sechellia
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dsec_GM24735
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dsec_GM24735
Glycosyltransferases [BR:dse01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dsec_GM24735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 889 aa AA seqDB search
MSATYTNTITQRRKTAKVRQQQQQQHQWTGSDLSGESNERLHFRSRSTNSMQQQHTANSN
SPSPLCCNGARALTMLNCCVDVNCHLNAPLRGSVNRHTTPTPTPTATPTPVPTPKQVSPS
PTSDRSRSLSPSPSTSRSRSLSCQKHINKNSAGAASAEERKTSSASSQPFTVNLSIDLFS
WTLFLLAFGTRFYKLATPPHIVFDELHYGKYISMYMRNIFFFDQHPPLGKQLIAGLVSLA
GYDGNYTFNRIGEPYSPEMPIFWFRFLPAMCGSLLAPAVYNLLLEAKLSRWSSALGGLLV
VLDNSLLTQSRFVLMESMLLLATTVGIACLLRFQRSRLGSLEWFFSGTTAAVCLGAAGTV
KYVGFLALGLAFYLMCRHLWQQLYDAGLTDRQLWMHAISRLLIFVGIPLAVYVGVFYVHF
KTLHRAGPHDSIMTSAFQASLDGGLASITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAV
YPVRYPDKRGSSHQQQVTCYSFKDVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGI
TSRALNSHDVAAAMTPQCQEVSCYIDYEIKMAGELLWRVEILNRDSEGDIWHAIKSEVRL
VHVSTDACLKFSGRQLPDWGFNQHEVVADRDKGIHEDAIWNVEEHRYTQTEDHRERERQM
LTAEMIPTKRTRISFWAKLLELQSKMLFQSKSVPSHMYSSMPHEWPLMDKGIAYWLDSQS
SAQIYLLGNILLWYTATTGILIYAGLLAFYAMRRQRLCFDISEHEWQRFVLAGDTFFMGY
VMHYLPYFCVDRTLFLHNYLPAFVFKLLLLCFVVEHLDYLLRRFCTGRGVHLVRLYRLML
ILWLVGVLSIFSKFIPFSYGARQMTLNEVRSLRWKDTWDFVLHKNHHLY
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccacctacaccaatacaataacacagcgccgcaagacggccaaagtgaggcag
caacaacaacaacaacaccaatggacgggcagcgatttgagcggcgagtcaaacgaaaga
cttcactttcgcagccgttcaacaaactcgatgcaacaacaacacacggcaaacagcaac
tcaccttcaccactgtgctgtaacggtgctcgtgctctaacaatgctcaattgctgcgtc
gacgtcaactgtcatttgaatgcgccgcttcgcggcagcgttaaccggcacacgacgcca
acgccgaccccaactgcgacgccaacgccggtaccgacgccaaaacaagtctccccttcg
cctacatccgatcgttcgcgctccctctcaccttcgccttcgacgtctcggtctcgctcg
ctctcctgccaaaaacacatcaacaagaacagcgcaggcgcagcatccgcagaagagaga
aaaacctctagtgcgagttcgcagccatttaccgttaacctgagcatcgatctcttcagt
tggacactctttctcttggccttcggcacgcgtttctacaagctggcaacgccgccgcac
atcgtattcgatgaactccactacggcaagtacatttccatgtacatgcgcaacattttc
ttcttcgatcaacatccgccgctgggcaaacagctgatcgccggactggtcagcctggct
ggctacgatggcaattacactttcaatcggattggtgagccctattccccggaaatgccc
atcttctggttccggtttctaccagccatgtgcggcagtctactggcccccgccgtttac
aatctgttgctggaggcgaagctcagtcgctggtcatccgctttgggtggcctgcttgtg
gtactggacaactccttgctgacgcaatcccgttttgttctgatggaatcaatgctactg
ctggcgaccacggtgggcatcgcctgtctgctccgcttccaacgtagtcgcctgggcagt
ctggaatggttctttagtggaacgacagctgctgtctgtttgggagccgccggaaccgtc
aagtacgtcggattcttggcactggggctagccttctatttgatgtgtcgacacctatgg
caacaactctacgacgccggtctcaccgatcgccagctatggatgcatgccataagtcgc
ctgttgatctttgttgggattccattggccgtctacgtgggagtcttctatgtccacttc
aagacgctgcaccgggctggaccgcacgatagtatcatgactagcgcgtttcaggcctcg
ttagatggaggactggcatcgatcacaaaaggacagccattggcagtggttcatggatcc
caaatcacactacgacacacccacggacgcacctgttggctgcactcgcatgcagctgtc
tatccggtgcggtatccggacaagaggggctcctcccaccagcagcaggtcacctgctac
tccttcaaggatgtgaacaactggtggctggttaagcgaccaacaaaggagaacctggtg
gtgggtgatgagccggatatcattcggcacggagaaattattcagttggtccatggaatt
acgagccgagctctgaactcacacgatgtggctgcggcaatgacgccgcagtgccaagaa
gtcagctgttacatagattacgagatcaagatggccggtgagctgttgtggcgcgtggag
attctgaatcgcgattccgagggtgacatttggcatgccatcaagtcggaggtccgcctc
gtacacgtgtccacagatgcctgcttgaagttcagtggccgccaacttcccgactggggt
ttcaatcagcacgaggtggtggcggatcgtgacaagggaatacatgaggatgccatctgg
aatgttgaggagcaccgctatacgcagactgaggaccatcgggagcgagagcgccagatg
ctaaccgccgagatgatacccacaaaacggacgcgcatctcgttctgggccaagctactg
gagctgcagtccaagatgctgttccaatcgaagtcagtgccaagtcacatgtacagctcc
atgccgcacgagtggccgctaatggacaagggcatcgcttactggttggactcacagtcc
agtgcgcagatctatttgctgggaaacatactgctctggtatacagccacaacgggaata
cttatctatgccggattactcgccttctacgctatgcggcgccaacgtctttgctttgat
atttcggagcatgagtggcagcgattcgttttagctggtgacaccttttttatgggctac
gtgatgcactatctgccgtatttctgtgtggatcgtacactcttcctgcacaattacttg
ccagcctttgtgtttaagttacttctattgtgctttgtcgtggagcatctggactatctg
ctcaggcgcttctgtaccggacgtggtgtccacctggtgcgcctgtatcgcctcatgcta
atcctgtggttggtgggcgtgcttagcattttctcaaagttcataccattcagttatggt
gcgagacaaatgaccttaaatgaggttcgcagtctgcgatggaaggatacctgggacttt
gtcctgcacaaaaaccaccacctgtactga

DBGET integrated database retrieval system