KEGG   Drosophila sechellia: Dsec_GM24885Help
Entry
Dsec_GM24885      CDS       T01064                                 

Definition
GM24885 gene product from transcript GM24885-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dse  Drosophila sechellia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsec_GM24885
   00052 Galactose metabolism
    Dsec_GM24885
   00500 Starch and sucrose metabolism
    Dsec_GM24885
   00520 Amino sugar and nucleotide sugar metabolism
    Dsec_GM24885
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dsec_GM24885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGR
FADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLVVIKLNGG
LGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVR
KYKGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLK
KFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLI
QMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNN
KTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSL
VMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaaggtgcgcggccaccagcgagcaccgtccgactcc
aaggagttccatgaggtgaccaaacgggatgcactacgtctgctggagcacgatgtggac
cgtctgctggagaccaccgagaaggcccgccagcctgccctcaaggcggaaatgggtcgt
ttcgccgatcttttcggacgtttcattcaggaagagggtcccgcattggactggaacaag
attcagaagttacctgagaatgctgtgatgaactactcgaatcttaagtcgcccaaaaac
gagcagaatgagatccgcaacatgttggataaattggttgtcatcaagctgaacggtggt
ttgggcacctcaatgggttgccatggtcccaagagtgtgattcccgtgcgttcggacctt
actttcctggatcttaccgtgcagcaaatcgagcatctcaacaagacctacgatgccaat
gttccgctggtactgatgaattctttcaacaccgacgaggataccgagaagatcgtgcgc
aagtacaaaggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcatc
agtcgcgagcactacctgccggtggccaaagactttgatgtcgaaaaggatatggaggcc
tggtatccacctggacacggtgacttctacgataccttccgcaactctggtctgctgaag
aagttcattgaggagggccgcgagtactgcttcttgtccaacatcgataacctgggcgcc
accgtcgatctgaacatccttaacaaactggtgggcgaggagcgtgccaccactcctgtg
gagtttgtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcatt
caaatggaaaacaagctgcgcctgttggaaattgcccaagtgccaccagagcatgtggat
gacttcaagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctg
gcagccattgatcgcgttttgcgtgagcgtaccctaaacatggaaattattgtgaacaac
aagacgctggagaacggaacccgtgttattcagctggagactgctgtgggtgcggccatg
aagtgctttgatggcgccatcggcatcaatgtgccacgttcccgtttcttgcccgtgaag
aagtcttcagatctgctgctggtcatgtcaaatttgtatacgcttaaaaacggcagcctg
gtaatgtcgccacagcgaatgttccctaccacgccgctcgtcaagctgggagagaaccac
ttctcgaaggtgaaggagttcctgggtcgcttcgccaacatcccggatatcattgagctg
gatcacttgaccgtgagcggagatgtgactttcggtcgtggcgtttctttgcgcggcact
gtgatcatcattgccaaccatggcgatcgtatcgatatcccagctggagccattctggag
aacaagattgtatctggcaatatgcgcatcttggaccattaa

DBGET integrated database retrieval system