KEGG   Drosophila sechellia: Dsec_GM24988Help
Entry
Dsec_GM24988      CDS       T01064                                 

Definition
GM24988 gene product from transcript GM24988-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dse  Drosophila sechellia
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dse00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dsec_GM24988
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsec_GM24988
Transcription factors [BR:dse03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dsec_GM24988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 933 aa AA seqDB search
MLESLDGFMMVFSSMGSIFYASESITSQLGYLPQDLYNMTIYDLAYEMDHEALLNIFMNP
TPVIEPRQTDISSSNQITFYTHLRRGGMEKVDANAYELVKFVGYFRNDTNTSTGSSSEVP
NGSNGQPAVLPRIFQQNPNAEVDKKMVFVGTGRVQNPQLIREMSIIDPTSNEFTSKHSME
WKFLFLDHRAPPIIGYMPFEVLGTSGYDYYHFDDLDSIVACHEELRQTGEGKSCYYRFLT
KGQQWIWLQTDYYVSYHQFNSKPDYVVCTHKVVSYAEVLKDSRKECQKSVNSNNTTNNGS
SKVIASTGTSSKSASATTTLRDFELSSQNLDSTLLGNSLASLGNETAATSPAVDSSPMWS
ASAVQPSGSCQINPLKTSRPASSYGNISSTGISPKAKRKCYFYNNRGNDSDSTSMSTDSV
TSRQSMMTHVSSQSQRQRSHHREHHRENHHSQSHHHMQQQQQHQNQQQPHQQHQQLQQQL
QHTVGTPKMVPLLPIAPTQIMAENACQFPQPAYPLANPQLVAPTFLEPPQYLTAIPMQPV
IAPFPVAPVLSPLPVQSQTDMLPDTVVMTPTQSQLQDQLQRKHDELQKLILQQQNELRIV
SEQLLLSRYTYLQPMMSMGFAPGNMTAAAVGNLGAGGQRGLNFTGSNAVQPQFNQYGFAL
NSEQMLNQQDQQMMMQQQQNLHTQHQHNLQQQHQSHSQLQQHNQQQHQQQQQQQQQQQQQ
QQQQQQQQQQQQQQHQQQQQQLQLQQQNDILLREDIDDIDAFLNLSPLHSLGSQSTINPF
NSSSNNNNQSYNGGSNLNNGNQNNNNRSSNPPQNNNEDSLLSYMQMATESSPSINFHMGI
SDDGSETQSEDNKMMHTSGSNLVQQQQQQQQQQILQQHQQQSNSFFSSNPFLNSQNQNQN
QLPNDLEILPYQMSQEQSQNLFNSPHTAPGSSQ
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgctggagtctctcgatggtttcatgatggtcttcagcagcatgggctccatcttctac
gcctcggaaagtattacctcccagctgggctatctgccgcaagatttgtacaacatgacc
atatatgacctggcctacgaaatggaccatgaggcgctgctgaacatctttatgaatccc
acaccggtaatcgagcccagacagacggacataagttccagtaaccagatcacattctac
acccatttgagacgcggcgggatggagaaagtggatgccaatgcctacgagttggtcaaa
ttcgtgggttactttcgtaacgataccaatacttcgacgggttccagttcagaggttccg
aatggctcaaatggacagcctgcggtgctgccgcgcatcttccagcagaatcccaatgca
gaggtggacaaaaagatggttttcgtgggcaccggacgcgtacagaatccccaactgatc
agggaaatgagcattattgatcccacaagtaatgagttcacctcgaaacacagcatggag
tggaagtttttgtttctggatcaccgggcaccgccgatcattggctatatgcccttcgag
gttctggggacatccggctatgattattaccactttgatgatctggacagtattgtggcg
tgccatgaagagctaaggcaaacgggtgagggcaagtcttgctactaccgattcctcacg
aaaggccaacagtggatatggttgcaaacggactactatgtgagctaccaccagttcaat
tccaaaccggactacgtggtctgcacccataaggttgtcagctatgccgaggttctgaag
gatagtcgaaaggagtgccaaaaatccgtaaatagcaacaacaccaccaacaatgggagc
agtaaggtaatagcctccacgggaactagcagcaaatccgcatctgccaccacaacactg
agggatttcgagctgagcagccaaaatctggatagcacattgctcggaaatagtctggcc
agtttgggcaatgaaacagcagccacttctcccgccgtggactcgtcgcccatgtggtca
gcgtcggctgtccaaccgtcgggatcatgccaaataaatcccctgaagacatcgcgtccc
gcctcgagttatggcaatatcagctccacaggaatatcgccgaaggctaagcgaaagtgc
tacttctacaacaaccgggggaatgactcggattcaacgtccatgtcgacggattcagtc
accagccggcagtccatgatgacgcacgtcagttcgcaaagccaacggcagcgatcgcat
caccgtgaacaccatcgagaaaatcatcacagtcagtcacatcatcacatgcagcaacag
cagcagcatcagaaccagcagcagccacatcagcagcaccagcaactgcaacagcagctg
caacatacagtgggtactccgaaaatggtgcctctcctgccgattgcgcccacacaaata
atggctgaaaatgcgtgtcagtttccccaacccgcctatccgcttgctaatcctcaactg
gtggcacccacatttctggagccgccgcaatatctcaccgccattcccatgcagccagtg
atcgctccgtttccggtggcgccagtgctttccccacttccggtgcagtcacaaacggat
atgctgcccgatacggtggttatgacgccaacacagagtcagttgcaggatcaattgcag
cggaagcacgacgaactgcaaaaactgatcctccagcaacagaatgagctgaggatcgtc
tcagagcagctccttctatcccgctacacatatctgcagcccatgatgtcgatgggattc
gcacctggcaacatgacagcagcagcggtgggtaatttgggagcaggtggccaacgggga
ctgaatttcaccggcagcaatgccgtgcagccacaattcaatcagtatggatttgccctg
aactcggagcagatgcttaaccagcaggatcagcagatgatgatgcagcagcagcagaat
ctgcacacgcagcaccagcacaatctgcagcagcaacatcagagccactcacagttgcag
caacataaccagcagcaacatcagcagcagcagcaacaacagcagcaacaacagcagcaa
caacagcagcagcaacagcagcagcaacagcagcaacaacagcaccaacagcagcagcaa
cagttgcagctgcagcaacaaaatgatattttactgcgtgaggatatcgatgatatagac
gccttcctcaatctgtcccccctgcactcactgggctcgcaatccaccattaatcccttc
aactccagcagcaataacaacaatcaaagctacaatgggggtagtaatctgaataatggc
aaccagaacaacaacaatcgcagttcgaatcccccgcaaaataacaacgaggactcgctg
ttgtcctacatgcagatggccaccgaatcgagtccttcgatcaactttcacatgggcatc
agcgatgatggctccgaaacgcagagcgaggacaacaagatgatgcacacttccggcagc
aatctggtgcagcagcaacagcagcagcaacaacaacaaatcctgcagcagcatcaacag
cagtcaaacagcttcttcagttcgaatccctttctcaacagtcagaatcagaaccaaaac
cagttgccaaacgatctggaaatattgccataccaaatgtcccaagagcaatcacagaat
ctattcaactcgcctcacacagccccaggcagtagtcaatag

DBGET integrated database retrieval system