KEGG   Drosophila sechellia: Dsec_GM25034Help
Entry
Dsec_GM25034      CDS       T01064                                 

Definition
GM25034 gene product from transcript GM25034-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dse  Drosophila sechellia
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM25034
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsec_GM25034
Translation factors [BR:dse03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsec_GM25034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 244 aa AA seqDB search
MVYTGYLSNGLQNAEDTEWLPYGDPSDWAHGLAPYDGLELMGGNEQEVQPSLNRVMKNID
YDLALKHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFND
YMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGECFEHSDEICGV
VINVRNKANKLSLWTKDSRNVEAILSIGRQIKDMLHLGIMEIQYQVHNDAMLNHGPNVNA
IYKL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacaccggttacttaagcaacggattgcagaatgctgaggacactgaatggttg
ccgtatggagatcccagtgactgggcacatggtctggcgccttatgatggtttggagctg
atgggcggcaatgagcaggaggtgcagccctctttgaaccgggtgatgaaaaacatcgac
tacgacctggccttgaagcatccattggagcatacctggactttgtggcacttggagaac
gatcgtaccaagcgctgggccgaaatgctcgtcgatgtgaccagcttcaacaccgttgag
gactttttcagtgtgtactactttgtgaagccgccatcggatctgaagatattcaatgac
tacatggtgttcaagaaaaatattcgtcccatgtgggaggatgacaccaacaagaacggt
ggtcgttggatactgctcctggacaaggcctccaggacctatatagataagatgtggcac
gatttgcttttgtgcatgattggcgagtgcttcgagcactcggacgagatatgtggagtg
gtcatcaatgtgcgcaacaaggctaataagctatccctttggacaaaggactcgcgcaat
gtggaggccatcctgtccatcggcaggcagataaaggacatgctgcatctgggcattatg
gagatccagtaccaggtgcacaacgatgccatgttgaaccatggacccaatgtcaatgcc
atctacaaattgtag

DBGET integrated database retrieval system