KEGG   Drosophila sechellia: Dsec_GM25166Help
Entry
Dsec_GM25166      CDS       T01064                                 

Gene name
Dsec_LanB2
Definition
GM25166 gene product from transcript GM25166-RA
Orthology
K05635  
laminin, gamma 1
Organism
dse  Drosophila sechellia
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dse04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1639 aa AA seqDB search
MKRSRWSHSGSSTARLLLIGVLFASCSTAILGAQRPPINSAGGHELRGTTFMPALECYDP
YGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQTMNQNHKNCEFCKYNDHNPSFLT
DLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTS
ESGPWIPYQFYSATCRDTYSLPDSRTIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEG
RPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKSYFYAISDIAVGARCK
CNGHASKCVPRTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACN
CNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGYCVNCACDPVG
SRSLQCNSQGKCQCKPGVTGDMCDRCDNNYYQFGPHGCQQCGCDTGGSHQNTPACDTETG
ICFCKENVEGRRCNECKPGFFNLDKTNRFGCTPCFCYGHTSECMTAPGYSIVSVTSNFNK
FKERWTAADLNQREVDIKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKL
QLVGQVANTGVSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSA
RGFLSILSNLTAIKIRATYSVQGEAILDDVELQTAHRGAAGHPATWIEQCTCPEGYLGQF
CESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYG
NALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGE
VQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCD
RCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDP
VGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNG
QCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAADLHRAKLFNLSQTLDEIAR
TPVTNDDEFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREHLVSAD
KFQTDANAEIDRARQNYTILDQITENAKKELQLALDLLNDEGAQALARAKEKSVEFGQQS
EQISDISREARALADKLESEAQFDLKNAKDAKDAVEKAHQLAKSAVDLQLKIGTELQSDV
GVELSHVKQSLGSVVQTSKEALRKANEVYDTALTLLNDVNRQTQPEIDISQLKKDAVAAN
ERADELLKQITELSNSNGELFADFETEQELTEALLKRAEQQQLEDIELLERAKAALDKAT
KAVEQGDNTLKEANNTYEKLAGFQSDVQRTSESAEKALQTVPNIEKEIQNAESLISQAEE
ALDGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLREEADQLNHRVK
LTEMDIFKLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANADLTAIKDELENLKD
INTGDLDKLENRLATVEGEINRVNLTGRIEKYREQRTIQKNLIDKYDAELRELKDEVQNI
GLISKALPDSCFSRNRLEP
NT seq 4920 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagccggtggagccacagtggctcctccacggctcgtctcctgctgatcgga
gtcctgttcgccagctgttccaccgccatcctgggcgcccagcgtccgcccatcaactcc
gccggaggtcacgaactgcgcggaaccaccttcatgccggccctggagtgctacgatcca
tacggcagaccgcagaaatgtctgccagaatttatcaatgctgcctatcaactgcaaatt
gagtcaactaatacctgtggtgagcagaacgacaaccacttctgcatacaaaccatgaac
caaaatcacaaaaactgcgaattttgcaagtacaatgatcataatccatccttcttgacg
gatttgcatgatccacaaagtccaacctggtggcagtcggagaccatgttcgagggcatt
cagcacccgaactatgtgaatctgactttgcaccttggaaaatcctatgacatcacctac
gtgcgcattctcttccgctcaccacgacccgaatcctttacgatttacaagaggacctcg
gagagtggaccctggattccgtaccagttctacagtgccacctgtcgcgacacttactcc
ctgccagattcgcgaaccattcgcaagggtgagggcgaggcccatgctctgtgtaccagc
gagtacagtgatatctcgccgttgagggacggtgagattgccttctccacgctggagggt
cgccccagtggcatcaatttcgagcgcagcggagagctgcaggagtgggtcacggccacg
gatatccgtatcacgctggaccgactgaacaccttcggtgacgaactcttcggtgattcc
caggtgctcaagtcgtacttttatgccatcagcgacattgccgtgggtgcgcgttgcaag
tgcaatggacatgccagcaagtgtgtcccgagaacgggaatgcatggcgagaggactctg
gtctgcgagtgccggcacaacaccgatggacccgattgcgatcgctgtctgccgctctac
aacgacctcaagtggaagaggtccacctcaacagaggtcaacgagtgcaaagcttgcaac
tgcaatggattggcggacaagtgcttcttcgacgcgaatctgttcaaccggacgggtcat
ggaggtcactgtctggattgccgagagaatcgcgatggacccaactgcgaacgctgcaag
gagaacttttatatgcgcgacgatggctactgcgtcaactgcgcctgcgatcccgtgggc
tccagatcgctgcagtgcaacagccagggcaagtgccagtgcaagccgggtgtgaccggc
gacatgtgcgatcgctgcgacaacaactactaccaattcggaccccatggatgccagcag
tgcggctgcgacactgggggatcccatcagaatacgcccgcctgcgatacggagactgga
atctgcttctgcaaggagaatgtggagggcagacgctgcaatgaatgcaaaccgggcttt
ttcaatctggacaagaccaatcgatttggatgcacaccctgcttctgctatggccacacc
tccgagtgcatgactgccccaggatactccattgtttcggtcacctcgaatttcaacaaa
ttcaaggaacgctggacggctgccgatttgaaccaacgcgaggtggacatcaagtacaac
cagtacagccggagcattggaaccaccgcccagggcaatgagcatgtgtacttccaggca
ccggatcgcttccttggcgatcagcgtgcctcctacaacagggatctgaaattcaagctc
cagctagttggtcaggtggccaataccggagtcagtgatgtgattttggagggtgctgga
agccgtatctcgctgcccatcttcgcccagggcaatggaatacccgaccagggtgtcaag
gagtacaccttccggctgcacgaacatcatgactaccagtggcaaccaagccagtcggct
cgaggattcctttcgattctgtctaatctgacggccattaagatcagggccacgtactcg
gtgcagggtgaggccatcctggacgatgtcgagctgcagacggcacatcgtggagccgcc
ggccacccggccacctggatcgagcagtgtacctgtccggagggttacctgggtcagttc
tgtgagtcctgtgctccaggctatcgccacagtcccgctcgcggcggtcccttcatgccc
tgcatcccctgcgattgccatggtcatgcggacatctgtgactcggagacgggcaggtgc
atctgtcagcacaacacccacggcgataactgcgatcagtgtgccaagggattctacgga
aatgccctgggcggaactcccaacgactgcaagcgttgcccctgtcccaatgatggtgca
tgcctgcagatcaacgaagatacggtcatctgtacggagtgcccgaaaggttacttcggt
tcccgttgcgagcagtgtagcgatggcttctttggagatcccacgggtctcctgggtgag
gtgcagacctgcaagagctgtgactgcaatggcaacgtggatcccaatgccgtgggcaat
tgcaaccggactacgggcgagtgcttaaagtgcattcacaatacagccggagagcactgt
gatcagtgtttgtccggacactttggtgatcctctggccttgccacatggacgctgtgat
cgctgcagttgctacgaggctggaaccgagcaggatgaacagagtatcactcgatgcgac
caagtcactggtcagtgccagtgcaagccgaatgtgattggaagggattgcggagagtgc
cagccgggctacttcaacatccgatcgggcaatggctgcgagaactgcctgtgcgatccg
gtgggcagctacaactccacctgtgatcgctactctggccagtgtcactgccgaccaggt
gtgatgggtcagcgatgcgatcagtgcgagaactatttctacggattctccagcgagggc
tgcaagccatgcgaatgcgacgagagcggctccaagggattccagtgcgaccagaatggc
cagtgtccttgcaatgataacgtggaaggacgtcgttgcgatcgctgcaaggagaacaaa
tacgacaggcatcggggttgcatcgattgccccgattgctacaacctcgtgcaagatgcc
gccgatttgcatcgtgccaagttgttcaatctcagtcaaacgctggacgagattgctcgc
acgccggtgaccaatgacgatgagttcgaggcgaagttgaaggcggtgcaagagaaggtg
gctgtcttggcccaggatgcccgcgataattccggtgatggtggtcagacatacgcagag
gtcatcgatgatcttcacaagcacctggacagcgtaagggagcatctggtgagcgcggat
aagttccagactgatgccaatgcggagatcgacagggcgcgccagaactataccattctg
gaccagatcaccgagaacgccaagaaggaactgcagctggccctcgacctcctgaatgac
gaaggtgcccaggctttggcgcgggccaaggagaagtctgtggaatttggacagcaatcg
gaacagatctcggacatctcgcgggaggctcgtgccctggccgacaaactggagtcggag
gcccaattcgatttgaagaacgccaaggatgccaaggatgcggtggagaaggcccatcag
ctggccaagagtgccgtcgacttgcagctaaagatcggcaccgagctgcagtcggatgtt
ggggtggagctgagtcatgtgaagcaatccctgggcagcgtagtgcagacctccaaggag
gctcttcgcaaagccaacgaggtctacgatacagcattgaccctgctcaatgatgtgaat
cgtcagactcaaccggaaatcgatatcagtcagttgaagaaggatgcagtggccgccaat
gaacgagcggatgagctactcaagcagattactgaattgtcaaacagcaacggcgagctc
tttgcggatttcgaaacggaacaggaactgacggaggcgctgctaaagagagctgaacag
cagcaactggaggacatcgagctgctagagcgagccaaggctgccctcgacaaggctacc
aaggcagtggaacaaggtgacaataccctaaaagaggcaaacaatacctacgagaagttg
gccggcttccagtcagatgttcagcgcacttcggagagtgcggagaaagccctgcagacg
gtgcccaacatcgagaaggagatccagaatgcggagagcctgatcagccaggcggaggag
gctctcgatggcgccaataagaatgccaacgaggccaagaagaatgcccaggaggcgcag
ctgaagtatgccgaacaggcttccaaggatgctgagctgatccgccgcaaggccaatgag
accaaggtagctgcccgcaatctgcgcgaagaggccgaccaactgaatcatcgcgtgaaa
ctcaccgaaatggacatattcaagctggaggagagctcgaccaaggacgacaatctggtg
gacgacgccaagcgaaaggtgggtcaggccaaggccgatacccaggaggcccagaagcag
atcgagaaggccaatgccgacctgacggccatcaaggatgagctggagaacctgaaggac
atcaacacgggcgatttggataaattggagaatcgtttggccactgtggagggtgagatc
aatcgcgtcaacctgacgggacgcatcgaaaagtaccgggaacagcgcactattcagaag
aatctgatcgacaagtacgatgccgagctgagggaactcaaggatgaagtccagaatatt
ggacttatttccaaggctctgcccgatagctgcttcagtcgcaatcgcctggaaccctag

DBGET integrated database retrieval system