KEGG   Drosophila sechellia: Dsec_GM25224Help
Entry
Dsec_GM25224      CDS       T01064                                 

Definition
GM25224 gene product from transcript GM25224-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dse  Drosophila sechellia
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dsec_GM25224
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dsec_GM25224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 234 aa AA seqDB search
MISFLFIVNRALSSSSSSISSAAASLTNKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEF
PSTFGFSISHTTRKPREGEDHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAV
REIQAQGRVCILDIEQKGVEQIRRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKR
LNAAQVEIDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELEEQQKQGVSVNLK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgggcgctcagcagcagcagcagcagcatcagc
agtgcagcggcatccttaacgaacaagaagatgaccgcccccggcccacgaccccttgtc
ctgtgcggaccctcgggatccggaaagagtacgctgctcaagaggctgttcgccgaattc
cccagcacctttggcttcagcatatcgcacaccacgcggaagccgcgtgagggcgaggat
catggggtgcactactactttgtggaacgcccggaaatggaggcagccatcgccggcgac
gagttcatcgagacggccgagtttacgggcaatctgtatggaacgagcaaggcggcggtt
agggagatccaggcacagggacgggtctgcatactggacatcgaacagaagggagtggag
cagatccgtcgtacggatctcaatcccatactgatcttcaacaatccaccgagcatcaag
gagctggagcgacgacttcgcaaacgtggctccgaaacggaggagtcgctgagcaagcgc
ctcaatgccgcccaggtggagatcgattatggtttgacgcccggcaacttccacaagatc
atcaacaacgtggacatcgatgtggcctacgaggagttccgcaactttgtcgtccaggaa
ctcgaggagcagcagaagcagggagtatcagttaacttgaagtaa

DBGET integrated database retrieval system