KEGG   Drosophila sechellia: Dsec_GM25587Help
Entry
Dsec_GM25587      CDS       T01064                                 

Definition
GM25587 gene product from transcript GM25587-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dsec_GM25587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 510 aa AA seqDB search
MWITGQFVFLLLVALVAAKTKSSAVQDDIAEYKDFKKLLRTKNNVLALYVTSAKSAAAEL
KIFREAAEAIRGTGTMLLLDCGQQNRKKLCKKLKVSPDPYAIKHYKDGDFHKDYDRQLSV
SSMITFMRDPSGDLPWEEDPDGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPDYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGEN
NKDALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGLFKFE
VNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDDDNFTSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLATLCAKYNVRGYPTILYFSYLK
TKLDYNGGRTSKDFIAYMNNPPTSADRTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcaccggtcagtttgtttttcttctgctggtggcacttgttgccgcaaaaacg
aaatcctcggctgtgcaggatgacatcgcagagtataaggacttcaagaagctgctgcgc
accaagaacaatgtcctcgcgctatacgtgaccagtgcgaagtccgctgctgccgagcta
aagatattccgtgaggcggcggaggcgatacggggaaccgggacaatgttgctgctggat
tgcgggcagcagaatcgcaagaaactgtgcaagaagctgaaagtatcgccggacccctac
gccattaaacactacaaggatggcgactttcacaaggactacgaccggcagctgagcgtc
agctccatgatcactttcatgcgtgatccctccggcgatctgccctgggaggaggatcca
gacggcaaggatgtcctgcacttcagcgacgccgcttccttcacaaagcatttacgcaag
gacatccggcctatgcttgtcatgttctatgttccctggtgcggattttgcaagaaaatg
aagccggactacggaaaagcgtccacggaactgaaaactaagggcggttatattctggcg
gcaatgaatgtagagcgacaggagaacgctcctatacgcaaaatgttcaacataactggt
tttcccaccctgatttactttgaaaatggcaagctgcgctttacatacgaaggagagaac
aataaggacgctttggtttcttttatgctcaacccaaatgccaagccaacgccaaagccc
aaggaacccgaatggtcggcggataccaactcggagattgtccatctaacctcgcagggt
tttgagcccgctctgaaggacgagaagtccgccctggtcatgttctatgcaccctggtgc
ggacactgtaagcgcatgaagccggaatacgaaaaggccgctctggagatgaagcagaaa
aagattcccggccttttggccgcgttggatgcaacgaaggagccgtcaatcgcagagaaa
tataaagtcaagggctatccaactgttaagtttttctcgaatggcctctttaagtttgaa
gtaaatgtacgcgaagcatcgaaaattgttgaatttatgagagatcccaaggagccccca
ccgcctccgccgcccgagaagagttgggaggaggaggaggacagcaaggaagttctattt
ctggatgacgacaacttcacttctacactgaagaggaaaaagcatgcgctggtcatgttc
tatgcaccctggtgtggacactgtaagcacacaaaaccggagttcacagcggctgccacg
gccttacaggatgaccctcggatagcgtttgtcgccatcgactgcacaaagcttgccacc
ctctgcgcaaagtacaatgtacgcggatatcccaccattctgtacttctcttacctcaaa
accaagctggattataatggcggacgcaccagcaaggactttatcgcctatatgaacaac
ccgcctacctcagcggaccgcacagagctgtga

DBGET integrated database retrieval system