KEGG   Drosophila sechellia: Dsec_GM25596Help
Entry
Dsec_GM25596      CDS       T01064                                 

Definition
GM25596 gene product from transcript GM25596-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 430 aa AA seqDB search
MSPNSMWIFGLISALLLTLGSTGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTE
PIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDEL
VDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFY
ATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLF
PKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFG
WIGEPSIAHSIILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIA
YGGDTYFVRLNRALFEVRRALRDMWLGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEE
DPDEDHEKKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctaattctatgtggatcttcggcctcataagtgctctgcttctgactctgggt
tcgacgggactatcctcaaaggttttggagctcagtgaccggttcatcgatgtgcgacac
gagggtcaatggttggtcatgttctatgccccgtggtgcggctactgcaagaaaacggag
cccatttttgctctggtggctcaggctctgcatgccaccaacgttcgagtgggtcgcctg
gattgcaccaagtatccggcggcagcaaaggagttcaaggttcgtgggtatcccaccatc
atgttcattaagggcaatatggagttcacctacaacggagaccgcggtcgagatgagctg
gtcgactatgccttgaggatgtctgggcctccagttcagctggtcacgcgaacggagagt
gtagacatgctaaagggatcccatacaatatttttcattttcgtgggccaacaggagggc
gtggtgtgggatacatactatgctgcagctgaaggttaccaagagcatggatttttctat
gccaccagcgaggatatcgctgcccagcactttgacttcgagaaactgccagcggtgatc
gtctacaaagaagagcagcaccacttctatccgcacgggcatttggcacatgaaatggac
cccaatgaagtgaacgaaaccgttttccagtgggtgaacgtggagaggttcacactcttc
ccaaaggtcactcggttcaacatccaccagctgctcaagactaacaagtacttggtattg
gctgtggtacaggaggataagctcaatcagatagccacgcatgagctggagtttcgggac
atggtggagggcgtgataagaaagcatagggcgcgatatcatgacaaattccaatttgga
tggattggcgagccatcaatagcacattccattatcttggatcaactacccacgcctcac
ttgatagcgattaattcgagcacccaacaccacttcatacccgaagatgatcccatgcaa
atgactccacaggcattgcaccttttcctagaatccatccgcaacgaaagtgcgattgcc
tatggaggagatacgtactttgtacgtttgaatcgggcgctgttcgaagtccgaagagcc
ctgagggatatgtggctgggaaatcccgtgctgaccactgttattttcggcctgccattg
ggattcttatcgctcatcatgtactcgatattctgcggcgattgtttggtcacagaagaa
gatcccgatgaagatcacgagaagaaggagtaa

DBGET integrated database retrieval system