KEGG   Drosophila sechellia: Dsec_GM25805Help
Entry
Dsec_GM25805      CDS       T01064                                 

Definition
GM25805 gene product from transcript GM25805-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dse  Drosophila sechellia
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsec_GM25805
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dsec_GM25805
Glycosyltransferases [BR:dse01003]
 Polysaccharide
  Storage polysaccharide
   Dsec_GM25805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 709 aa AA seqDB search
MRRQQSYRFEDNESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFM
IAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSDITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIA
GRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVA
DDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSS
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGS
KNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacagcagtcctaccgtttcgaggacaacgagtccacctcttacgccctgagg
atgaatcgtcgcttttcgagagtggagtccggggcggaccttaaggattatttcgatcgg
ggtgatatcgcttcccgggagaaccgctggaacttcgaggtggcatgggaggtggccaac
aaggtgggcggtatttacacggtgatccggtcgaaggcatatgtctccaccgaggagatg
ggcgagcagttgtgtatgatgggtccctacaaggagcactgtgcccgcaccgagatggag
gagatggagttccccaggggaaaccccctactagacgctgtcaattcattgcgctcgcga
ggctataaaatccacaccggtcgctggctggtggacggaaatcctcaattaatccttttc
gatattggatcagccgcctggaagctggatcagttcaaatcggagatgtgggagaagtgc
catattggaatacctcatttggatatcgagacgaacgatgccattatccttggctttatg
attgccgagttcctggaggagttccgcaactttgccgtgacttattcgcaaaacaacgaa
ctgagcgctccgaggattgtcgcccacttccacgaatggcaagctggcgtgggactcatt
gtcctacgtactcgtctggtggagatcgccactgtgttcactacccacgccacattgttg
ggtcgttacttgtgcgccggcaacaccgatttctacaacaatctggacaagttcgccgtg
gacgaggaggcgggcaagcgccaaatctaccatcgctattgcctggagcgaggtgccact
cacttggctcatgtgttcaccaccgtctccgatattacgggctacgaggcggagcatcta
ctcaagcgcaaaccggacatcatcacgcccaatggactgaacgtgaagaagttctcggcc
atccacgagttccagaacttgcacgccgttgccaaggagaagatcaacgaattcgtgcgg
ggtcacttttacggccacattgactttgatttagataagaccctgtacttcttcatcgcc
ggtcgctacgagtttggcaacaagggagccgacatcttcatcgaggcactggctcgcttg
aacgcgatgctcaagcacgagaagccggacaccacggtggtggccttcctcatcttcccc
accaagaccaacaacttcaacgtggactcgctgcgaggacatgccgttatcaagcagttg
cgcgatacgatcaacaacgtccagcaggccgtgggcaagcggatgttcgacacttgcctg
cagggcaacatacccaatgccgatgatctgcttcagaaggatgacctggtcaagatcaag
cgttgcatgttcgccatgcagcgcgattcgatgccgcctgttaccacgcacaatgtggct
gatgactggaatgatccggtgctatcctcaatccgtcgttgccatctgttcaactcgcgc
cacgatcgtgtcaagatggtcttccatccggagttcctcacatccacaaatcctctgttt
ggaatcgactacgaagaatttgtccgtggctgccacttgggtgtcttcccctcatactac
gagccctggggttacactcccgccgagtgtacggtgatgggtatcccgagcgtaaccacc
aatctgtccggctttggctgcttcatggaggagcacatcagtgatccaaagtcctacggt
atctacatcgtggatcgccgctatatcggcttggagaacagcgttcagcagctgtccagc
tttatgatggagttctccaggctgaaccgccgccagcgcattatccagcgtaatcgcacg
gagcggttgagcgatcttctggactggcgcaccctgggcatttactacagacaggccagg
gttaaggccctgcaagctgtttacccagactatgtggatgaattgtctctttatggatcg
aagaacaacttgatcttctcgcgaccgcacagcgaacctcccagtcctacttcatcgcgg
cacaccactccagctccatcggttcacggttcggatgacgaggactccgtggatgaggag
accgaactcaaggaattggggattaagtag

DBGET integrated database retrieval system