KEGG   Drosophila sechellia: Dsec_GM25956Help
Entry
Dsec_GM25956      CDS       T01064                                 

Definition
GM25956 gene product from transcript GM25956-RA
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dse  Drosophila sechellia
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dse00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 646 aa AA seqDB search
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSGPVRGRSVTVQ
GREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRLSATCVQERYEYFPGFSGEEI
WNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLP
ILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEA
PGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQWN
SYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDK
DDATALPRDKYLEIMNNIFGKATQAEREAIISSWEGNPGYQNQQQIGRAVGDHFFTCPTN
EYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVEREL
GKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFWND
YLPKVRSWAGTCDGDSGSASISPRVQLLGIAALIYICAALRTKRVF
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcctgtcggcagagcagagtcctgcccatgtccttgcccctgcccctggcc
atcccgctgcccctggtgctggtgctatcgctgcacctgtccggcgtctgcggcgtcatc
gatcgcctggtcgtgcagacatcctccggacccgtgcgcggtcgctccgtgacggttcag
ggcagggaggtgcatgtctacacgggcatcccctacgccaagccgcccgtcgaggacctg
cgcttccgaaagccggttcccgcggagccatggcacggcgtcctcgacgccacacggtta
tcagccacctgcgtccaggagcgttacgagtacttccccggcttctccggcgaggagatc
tggaaccccaacaccaacgtgtccgaggactgcctctacataaatgtctgggcgccggca
aaggcccgacttcgccatgggcggggtgccaacgggggcgagcaccccaatggcaaacag
gcggacactgaccatctcatccacaacggaaatccgcagaacacaaccaacggactgccg
attctgatctggatctatggcggtggcttcatgaccggatcggccaccctggacatctac
aatgcggatatcatggccgccgtgggcaatgtgatagtggcctccttccagtatcgagtt
ggtgcatttgggttcctgcacctggcgccggaaatgccgtcggagttcgcggaagaggcg
cccggcaatgtgggcctatgggatcaggcactcgccattcgctggctgaaggacaacgcc
catgcttttggcggaaatccggagtggatgaccctgttcggggagtcggctggatccagt
tcggtgaatgcccagctcatgtcgccggtgaccaggggcctggtcaagcggggtatgatg
cagtcgggcaccatgaacgccccctggagccacatgacctccgagaaggccgtggagatc
ggcaaggcgctgatcaacgactgcaactgcaatgcatccatgctgaagaccaatcccgct
cacgtgatgagctgcatgcgttccgtggacgccaagaccatatcggtgcagcagtggaac
tcctactcgggcatcctcagcttcccctcggcgcccaccattgatggtgcgttcctgccg
gcggatcccatgacgctgatgaagacggcggatctgaaggactacgacatcctgatggga
aatgtcagagatgagggcacttacttcttgctgtacgatttcatcgattacttcgataag
gacgatgccacggccctgccacgggacaaatacttggaaattatgaacaacattttcggc
aaggcaacgcaagcggaacgcgaggccatcatttccagttgggaaggcaatcctggctat
cagaaccagcagcaaatcggacgcgccgtgggcgatcactttttcacctgccccacgaac
gagtatgcccaggctctggcggagcgaggcgcctccgtgcactactactactttacacac
cgcacaagcacctcgttgtggggcgagtggatgggcgtgctgcacggcgatgagatcgag
tacttctttggccagccgctgaacaactccctgcagtatcgacctgtggagcgtgagctg
ggcaagcgtatgctcagtgcggtcatcgagtttgccaagacgggaaatcccgctcaggat
ggcgaggagtggcccaacttctccaaggaggatcccgtctactatattttcagcaccgac
gataagatcgagaaattggccaggggtcctttggcggctcgctgctcgttctggaacgat
tacttgccaaaagtcaggagttgggcaggtacttgcgatggcgattcgggaagtgcttcc
atatccccgagggtccagctccttggaatcgctgctctgatctacatctgcgccgcattg
cgaaccaaaagggttttctaa

DBGET integrated database retrieval system