KEGG   Drosophila sechellia: Dsec_GM26133Help
Entry
Dsec_GM26133      CDS       T01064                                 

Definition
(RefSeq) GM26133 gene product from transcript GM26133-RA
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dse  Drosophila sechellia
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsec_GM26133
   00053 Ascorbate and aldarate metabolism
    Dsec_GM26133
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsec_GM26133
   00860 Porphyrin and chlorophyll metabolism
    Dsec_GM26133
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsec_GM26133
   00982 Drug metabolism - cytochrome P450
    Dsec_GM26133
   00983 Drug metabolism - other enzymes
    Dsec_GM26133
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsec_GM26133
Glycosyltransferases [BR:dse01003]
 Others
  Hydrophobic molecule
   Dsec_GM26133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 517 aa AA seqDB search
MRLLPVIAIVFCALSAKPLQTESAKILATLPFPGRSQYIFLESYLKALAAKGHQVTVINA
FKNKETPNMRFIEALKAHDFAEEMMTLLNVPLLWQQLNAIDYILNKFIDTTMEDEGVQKL
LNSGETFDLVLAEMLQMEPLYALAQHFNATLVGFSSFGTDRTIDEAAGNISPISYNPLVT
SPRTDRMTFLERLENHYDVIVEDIHRHFIHLPHMRKVFKKYFPNAKKTMEEVMDSFSLIL
LGQHFSLSYPRPYLPNMIEVGGMQISHKPKPLPEDIKQFIEGSPHGVIYFSMGSNVKSKD
LPQETRDTLLKAFAKLKQRVLWKFEDDEMPGKPANVLIKKWYPQPDILAHPNVKLFISHG
GLLSSTESVYFGKPILGLPCFYDQHMNVQRAQRVGFGLGLDLNNMKQEDLEKAIQTLLTD
PSYAKAALTISERYRDQPESAVDRAVWWTEYVIRHNGAPHLRAASRDLNFIQLHSLDTFA
VILAVPLLVTLLILKLSCKLLRGKKQKCPHSDKLKKH
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagattattgcctgtgatcgcgatcgtgttttgcgctttgagcgccaagccgcttcaa
acggaaagtgcgaagattttggcaacgctgccgtttccgggtcgatctcagtacatattt
ttggagagctacttgaaagccttggcagctaagggtcaccaggtgaccgttatcaatgcc
ttcaagaacaaggagacgccaaacatgcgctttattgaggcactcaaagcgcacgacttt
gctgaagaaatgatgacgttgctgaatgtgcctctattgtggcagcagctcaatgccata
gattacatattaaacaaattcatcgatacaacaatggaggatgagggtgtccagaagcta
cttaactcgggagaaactttcgatctggtgctggcggagatgctccaaatggaaccactg
tacgctcttgcccagcatttcaatgccactttagtgggattctccagctttggaaccgat
agaacaattgacgaggcagctggaaatatatcacccatatcatacaacccgctggtgacc
tctcctcgaaccgatcggatgacctttctggagcgcttggaaaaccactacgatgtcatt
gtggaggacattcatcggcacttcattcacctgccacatatgagaaaggttttcaaaaag
tatttcccgaatgcgaagaaaaccatggaggaagtgatggatagtttttcgttgattctg
ctgggccagcacttttctttgagctatccgcgaccctatttgcccaacatgatagaggtc
ggaggaatgcaaatctcgcacaagccgaaaccactgccagaagacattaaacagtttatt
gagggttcgccacatggtgttatatacttctccatgggctccaatgtgaagagcaaggat
ctgccacaggaaactcgagatacgctgctgaaggcctttgccaaattgaagcagcgagtg
ctgtggaaattcgaagatgacgagatgcctggaaagccagctaatgtgctgatcaagaaa
tggtatccccagccggatattctggcccatccgaatgtgaaattgttcatcagccacggt
ggtctgctgagcagcaccgaaagcgtttacttcgggaaacccatcctgggattgccgtgc
ttctatgatcagcacatgaatgtgcagcgcgcccaacgagtgggcttcggcttgggcttg
gatctgaataatatgaagcaggaggatttggaaaaggccatccaaacgctgctcaccgat
ccgagttatgccaaagcagccttaaccatttccgagcggtatcgtgatcaaccggaatca
gctgtcgatcgcgctgtctggtggacggagtacgtgatcaggcacaatggtgctccacac
ctgcgagcagcttcccgagatctcaacttcattcaactgcacagcttggacactttcgct
gtgatactggccgtacctctactagtcactctgttaatcctaaagttatcttgtaaatta
ctgagaggcaagaaacagaagtgcccacattctgataagctcaagaagcattag

DBGET integrated database retrieval system