KEGG   Drosophila sechellia: Dsec_GM26176Help
Entry
Dsec_GM26176      CDS       T01064                                 

Definition
GM26176 gene product from transcript GM26176-RA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dsec_GM26176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 325 aa AA seqDB search
MSCNYADGLSAYDNKGILGAPESFDSDEDVAEKCQELADLIKKSGHVVLHTGAGISTSAG
IPDFRGPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHL
KSGLDRKYLSELHGNIYIEQCKKCRRQFVSPTAVETVGQKSLQRACKSSMDSKGRTCRYG
ILYDNVLDWEHDLPENDLEMGLMHSTVADLNIALGTTLQIVPSGDLPLKNLKRGGKFVIC
NLQPTKHDKKANLIVSSYVDVVLSKVCKLLGVEIPEYSEAADPTKQSKPMEWTIPTSNVN
TFHKKYNKYVKDSKIESKAKKTKYT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaactacgcggatggattgtcagcctacgacaacaagggaatcctgggagca
ccagagagtttcgacagcgatgaggatgtggccgaaaagtgtcaggaactggctgatttg
atcaagaaatccgggcacgttgtactgcacacgggagctggaatcagtacgtccgcaggg
attccggatttccgtggacccaaaggcgtttggaccctggaggagaagggcgagaagccg
gacttcaatgtctccttcgatgaagccagaccaactaaaacccacatggctatcatagcc
ctgattgaaagtggctatgtgcagtacgtaatctcccagaatattgatggtctccacttg
aaatccggactggatcggaagtatctttccgagttgcacggcaacatttacatcgaacag
tgtaagaaatgcagacgacaatttgtgagccctactgccgtggaaacagtgggtcaaaaa
tcccttcaacgtgcctgcaagtcttcaatggatagcaaaggtcgtacctgcagatatgga
atcctatacgacaacgttctggactgggagcatgaccttcccgaaaacgaccttgaaatg
ggtttgatgcactccaccgtcgctgacctaaatattgcgcttggaaccactttgcaaatc
gtccccagcggagatcttcctttaaagaatctaaaacgcggtggaaaatttgtcatttgt
aatctgcagcccacaaaacatgacaaaaaggcaaacttaatcgtatccagctatgtggat
gtggttttgtcaaaggtgtgtaaactattgggtgttgagatacccgaatattcagaggca
gccgatcctacaaagcagtccaagccaatggagtggaccatacccacaagcaatgtaaat
acctttcataaaaagtataacaagtatgtaaaagactcaaaaattgaatctaaagctaag
aaaacgaagtacacgtaa

DBGET integrated database retrieval system