KEGG   Drosophila sechellia: Dsec_GM26519Help
Entry
Dsec_GM26519      CDS       T01064                                 

Definition
(RefSeq) GM26519 gene product from transcript GM26519-RA
Organism
dse  Drosophila sechellia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 179 aa AA seqDB search
MGKMFASSGILVLGVLLVSAIGGQSESIPCKLIDAKHGKVCVCTADYCDYLENPVLTDEN
EWFLISSSKQGLRFSTTSDKFGKEEKFTVQDYVEPTQETANATILSRLFDKVVASAFTLE
SRESSITRTVTLRLDRSKTHQKMVGFGGSYTGAVEYLVKNFKRSELADHLYKSFYARMS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatgttcgccagcagtggaatcctggtgctgggagtgcttctggtatcggca
attggtggccaatctgaatcgatcccctgcaaactcatcgatgccaaacatggcaaagtg
tgcgtctgcacggcggactattgtgactatctggagaatcccgtcctgacggacgaaaat
gagtggttcctgatctccagttctaaacagggtctacgcttctccacaactagtgacaaa
ttcgggaaggaggagaagtttaccgtgcaggattatgtggaacccacccaggagactgcg
aatgcgacaatcctgtctcgtttgttcgataaggtggtggccagtgctttcaccttggag
tcccgggagagctccataactcgcacggtgaccctgcgactggacagaagtaagacccac
cagaagatggttggtttcgggggcagctacaccggagcagtggaatacctggtgaagaac
ttcaagcgttcagaactggctgaccatctgtacaagtccttttacgcgaggatgagctga

DBGET integrated database retrieval system