KEGG   Drosophila sechellia: Dsec_GM26522Help
Entry
Dsec_GM26522      CDS       T01064                                 

Definition
GM26522 gene product from transcript GM26522-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dse  Drosophila sechellia
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dsec_GM26522
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsec_GM26522
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dsec_GM26522
Enzymes [BR:dse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dsec_GM26522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 551 aa AA seqDB search
MKRIAGAPDWQLPCDLRETSHGSVCVCNSTYCDYLEPPQLTDISQIVVISSSKDGLRFKK
TTGDLSEKKPITIDDKQFTDENFKPDAIVVDQERAWLQLANIPQSLFINASIKTYRISVK
REQSFQNVSIFGGAFTGTVSYLLKELPEELQDHVYRSYFHPVGIAYNTIRMSIGGSDFDM
EPWAYNELPLHDPKLSNFTELDPRDLQKVEQLKRLKTIAKVDTLKIMGAAWSAPTWMKSN
NRWTGFGQLKSEYYQTWALYHLKFLELMRAKNMPIWAISTGNEPLNGVIGFFFVHFMSMG
WTPWQQAIWLNDNLGPTIRNSAESKVLIFGNDDQRYTYPTWFRRMRSSRNNSLSYLDGLA
VHWYWDELIAPQLIDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRAYTQ
DLTHNFNGWLDWNLVLDEQGGPNYIKNFVDAPIIVNATSRAEIYKQPIFYAIGHFSKFLP
PESVRIETRIENQGNPFTQLSVVGFQRPDGSVALIIYNGQNLPVDVALDDSQRGAIQLRL
PPRSWHTVLYK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcaggtgctcccgactggcagttgccctgcgatttgcgcgaaacgagc
catggaagcgtgtgtgtctgcaacagcacctactgcgactatctggaaccgccgcagctc
actgatatctcgcagattgtggtgattagctccagcaaggatggcttgcgcttcaagaag
acaacaggggatctctcggaaaagaaacccataacaatagatgacaaacagttcaccgat
gagaacttcaagccagatgcgattgtggtggatcaggagagagcctggctgcagttggcc
aacattccccaaagcctttttattaatgccagcattaagacatatcgcatatcggtgaaa
cgagagcagagttttcaaaatgtctccatttttggcggggcctttacaggtacagtctcg
tacttactcaaagaactaccggaggagctacaggatcatgtctacagatcctatttccat
ccggttggaattgcctacaacactatacgaatgtccattgggggctccgactttgatatg
gaaccctgggcatacaatgaattgcctcttcatgatccgaaattgagcaacttcaccgag
cttgatccgcgggatctgcagaaagtggaacagctgaaacgccttaagaccatcgctaaa
gtagatactctgaaaatcatgggcgccgcctggagtgctccaacctggatgaagagcaat
aaccgctggacaggattcgggcagctgaaatcggaatactaccaaacgtgggccctctat
cacctcaaatttctcgaacttatgcgggctaaaaatatgccgatttgggccatatccact
ggcaatgagccgttgaacggcgtcattggcttcttttttgtacacttcatgagcatgggc
tggacgccctggcagcaggctatctggctgaacgacaatctgggcccgaccatcaggaac
tcggcggagagcaaggtgctcatttttggcaacgacgatcagcggtatacctacccaacg
tggttccggaggatgcgctcctcacgcaacaattcgctgagctacttggatggcctagct
gttcactggtactgggatgaactgatagctccacaactcatcgaccaggcacacacggat
atgcccaataagctgctattgaacacggagtcctgcatcggtgataagccatggcagacc
catggtcccgagctgggcagctggcagcgtggtgagagctacatgagggcctacacccag
gatctgacgcacaacttcaacggctggctggattggaatctcgtgctggacgaacagggc
ggtccgaactacattaagaacttcgtggacgctccgatcattgtgaatgccacgagccgg
gctgagatatacaagcagccgatcttctatgccataggccacttctccaagttcctgccg
ccggaatccgtgcgcatcgagacgcgtatcgagaaccagggcaatcccttcacccagcta
agtgttgtgggcttccagcgaccagacggtagcgtggcgttgatcatctacaatggccag
aacctgccggtggacgtggctctcgatgatagccagcgtggagcgatccagctccgcctg
ccgccgcgctcctggcacacggtgctctacaaatga

DBGET integrated database retrieval system